The store will not work correctly when cookies are disabled.
Protein or Target Summary
Regulator of chromosome condensation
| Gene ID | 1104 |
|---|
| uniprot | P18754 |
|---|
| Gene Name | RCC1 |
|---|
| Ensernbl ID | ENSP00000362937 |
|---|
| Sequence | MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 1104 | RCC1 | Regulator of chromosome condensation | P18754 |
| MOUSE | 100088 | Rcc1 | Regulator of chromosome condensation | Q8VE37 |
| MOUSE | | Rcc1 | Regulator of chromosome condensation | A2CER2 |
| MOUSE | | Rcc1 | Uncharacterized protein | Q3V4B4 |
| MOUSE | 100088 | Rcc1 | Uncharacterized protein | Q3U6D2 |
| MOUSE | 100088 | Rcc1 | Rcc1 protein | Q6PFB2 |
| RAT | 682908 | Rcc1 | LOC682908 protein | B1H227 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
