The store will not work correctly when cookies are disabled.
RCC1
| Description | Regulator of chromosome condensation |
|---|
Gene and Protein Information
| Gene ID | 1104 |
|---|
| Uniprot Accession IDs | Q16269 Q6NT97 |
|---|
| Ensembl ID | ENSP00000362937 |
|---|
| Symbol | CHC1 CHC1 RCC1-I SNHG3-RCC1 |
|---|
| Sequence | MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 100568439 | RCC1 | regulator of chromosome condensation 1 | 9598 | VGNC:1486 | Inparanoid, OMA, EggNOG |
| Mouse | 100088 | Rcc1 | regulator of chromosome condensation 1 | 10090 | MGI:1913989 | Inparanoid, OMA, EggNOG |
| Rat | 682908 | Rcc1 | regulator of chromosome condensation 1 | 10116 | RGD:1592835 | Inparanoid, OMA, EggNOG |
| Dog | 487332 | RCC1 | regulator of chromosome condensation 1 | 9615 | VGNC:45440 | Inparanoid, OMA, EggNOG |
| Horse | 100070733 | RCC1 | regulator of chromosome condensation 1 | 9796 | VGNC:22267 | Inparanoid, OMA, EggNOG |
| Cow | 534142 | RCC1 | regulator of chromosome condensation 1 | 9913 | VGNC:33825 | Inparanoid, OMA, EggNOG |
| Pig | 100621543 | RCC1 | regulator of chromosome condensation 1 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100020625 | RCC1 | regulator of chromosome condensation 1 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | | RCC1 | regulator of chromosome condensation 1 [Source:HGNC Symbol;Acc:HGNC:1913] | 9258 | | OMA, EggNOG |
| Anole lizard | 100553743 | rcc1 | regulator of chromosome condensation 1 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 548855 | rcc1 | regulator of chromosome condensation 1 | 8364 | XB-GENE-979094 | Inparanoid, OMA, EggNOG |
| Zebrafish | 406457 | rcc1 | regulator of chromosome condensation 1 | 7955 | ZDB-GENE-040426-2216 | Inparanoid, OMA, EggNOG |
| C. elegans | 174332 | ran-3 | Regulator of chromosome condensation | 6239 | | Inparanoid, OMA |
| Fruitfly | 38669 | Rcc1 | Regulator of chromosome condensation 1 | 7227 | FBgn0002638 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 852782 | SRM1 | Ran guanyl-nucleotide exchange factor | 4932 | S000003065 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
