JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Gap junction alpha-4 protein

Gene ID	2701
uniprot	P35212
Gene Name	GJA4
Ensernbl ID	ENSP00000343676
Family	Belongs to the connexin family. Alpha-type (group II) subfamily.
Sequence	MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	2701	GJA4	Gap junction alpha-4 protein	P35212
MOUSE	14612	Gja4	Gap junction alpha-4 protein	P28235
MOUSE		Gja4	Gap junction protein	Q6PHB9
MOUSE	14612	Gja4	Gap junction protein	Q3UPZ2
RAT	25655	Gja4	Gap junction alpha-4 protein	Q03190

Protein Classes

PANTHER Classes
protein / cell junction protein / gap junction / Gap junction alpha-4 protein

DTO Classes
protein / Cell-cell junction / Gap junction / Gap junction alpha-4 protein

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx