RARA
Description | Retinoic acid receptor alpha |
---|
Gene and Protein Information
Gene ID | 5914 |
---|---|
Uniprot Accession IDs | B8Y636 P78456 Q13440 Q13441 Q96S41 Q9NQS0 RAR-alpha |
Ensembl ID | ENSP00000254066 |
Symbol | NR1B1 RAR NR1B1 |
Family | Belongs to the nuclear hormone receptor family. NR1 subfamily. |
Sequence | MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP Show more |
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
---|---|---|---|---|---|---|
Chimp | 454647 | RARA | retinoic acid receptor alpha | 9598 | VGNC:9556 | OMA, EggNOG |
Mouse | 19401 | Rara | retinoic acid receptor, alpha | 10090 | MGI:97856 | Inparanoid, OMA |
Rat | 24705 | Rara | retinoic acid receptor, alpha | 10116 | RGD:3534 | Inparanoid, OMA |
Dog | 480526 | RARA | retinoic acid receptor alpha | 9615 | VGNC:45351 | Inparanoid, OMA |
Horse | 100054274 | RARA | retinoic acid receptor alpha | 9796 | VGNC:22184 | Inparanoid, OMA |
Cow | 534280 | RARA | retinoic acid receptor alpha | 9913 | VGNC:33729 | Inparanoid, OMA |
Opossum | 100015353 | RARA | retinoic acid receptor alpha | 13616 | Inparanoid, OMA | |
Anole lizard | 100562365 | rara | retinoic acid receptor alpha | 28377 | Inparanoid, OMA | |
Xenopus | 100038052 | rara | retinoic acid receptor alpha | 8364 | XB-GENE-480836 | Inparanoid, OMA |
Zebrafish | 30680 | raraa | retinoic acid receptor, alpha a | 7955 | ZDB-GENE-980526-284 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / transcription factor / Retinoic acid receptor alpha
protein / receptor / Retinoic acid receptor alpha
protein / nucleic acid binding / Retinoic acid receptor alpha
protein / C4 zinc finger nuclear receptor / Retinoic acid receptor alpha
protein / transcription factor / Retinoic acid receptor alpha
protein / receptor / Retinoic acid receptor alpha
protein / nucleic acid binding / Retinoic acid receptor alpha
protein / C4 zinc finger nuclear receptor / Retinoic acid receptor alpha
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|