Protein or Target Summary

Retinoic acid receptor alpha

Gene ID	5914
uniprot	P10276
Gene Name	RARA
Ensernbl ID	ENSP00000254066
Family	Belongs to the nuclear hormone receptor family. NR1 subfamily.
Sequence	MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	5914	RARA	Retinoic acid receptor alpha	P10276
MOUSE		Rara	Rara protein	Q4FK21
MOUSE		Rara	Rara protein	Q5BLJ8
MOUSE	19401	Rara	Uncharacterized protein	Q3U5E7
MOUSE	19401	Rara	Uncharacterized protein	Q3U3R3
MOUSE	19401	Rara	Retinoic acid receptor alpha	P11416
RAT	24705	Rara	Retinoic acid receptor, alpha	A0A0G2JW78
RAT	24705	Rara	Retinoic acid receptor, alpha	Q499N1

Protein Classes

PANTHER Classes
protein    /    transcription factor    /    Retinoic acid receptor alpha
protein    /    receptor    /    Retinoic acid receptor alpha
protein    /    nucleic acid binding    /    Retinoic acid receptor alpha
protein    /    C4 zinc finger nuclear receptor    /    Retinoic acid receptor alpha

DTO Classes
protein / Nuclear receptor / Retinoic acid receptors / Retinoic acid receptor alpha

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx