Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

RARA

DescriptionRetinoic acid receptor alpha

Gene and Protein Information

Gene ID5914
Uniprot Accession IDs P10276 B8Y636 P78456 Q13440 Q13441 Q96S41 Q9NQS0 RAR-alpha
Ensembl ID ENSP00000254066
Symbol NR1B1 RAR NR1B1
FamilyBelongs to the nuclear hormone receptor family. NR1 subfamily.
Sequence
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp454647RARAretinoic acid receptor alpha9598VGNC:9556OMA, EggNOG
Mouse19401Rararetinoic acid receptor, alpha10090MGI:97856Inparanoid, OMA
Rat24705Rararetinoic acid receptor, alpha10116RGD:3534Inparanoid, OMA
Dog480526RARAretinoic acid receptor alpha9615VGNC:45351Inparanoid, OMA
Horse100054274RARAretinoic acid receptor alpha9796VGNC:22184Inparanoid, OMA
Cow534280RARAretinoic acid receptor alpha9913VGNC:33729Inparanoid, OMA
Opossum100015353RARAretinoic acid receptor alpha13616Inparanoid, OMA
Anole lizard100562365rararetinoic acid receptor alpha28377Inparanoid, OMA
Xenopus100038052rararetinoic acid receptor alpha8364XB-GENE-480836Inparanoid, OMA
Zebrafish30680raraaretinoic acid receptor, alpha a7955ZDB-GENE-980526-284Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transcription factor    /    Retinoic acid receptor alpha
protein    /    receptor    /    Retinoic acid receptor alpha
protein    /    nucleic acid binding    /    Retinoic acid receptor alpha
protein    /    C4 zinc finger nuclear receptor    /    Retinoic acid receptor alpha
DTO Classes
protein    /    Nuclear receptor    /    Retinoic acid receptors    /    Retinoic acid receptor alpha

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      The page will load shortly, Thanks for your patience!
      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      The page will load shortly, Thanks for your patience!