The store will not work correctly when cookies are disabled.
RBBP4
Description | Histone-binding protein RBBP4 |
---|
Gene and Protein Information
Gene ID | 5928 |
Uniprot Accession IDs | B2R6G9 B4DRH0 D3DPQ3 P31149 Q53H02 Q96BV9 |
Ensembl ID | ENSP00000362592 |
Symbol | RBAP48 NURF55 RBAP48 lin-53 |
Family | Belongs to the WD repeat RBAP46/RBAP48/MSI1 family. |
Sequence | MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Macaque | 708710 | RBBP4 | RB binding protein 4, chromatin remodeling factor | 9544 | | Inparanoid, OMA |
Mouse | 19646 | Rbbp4 | retinoblastoma binding protein 4, chromatin remodeling factor | 10090 | MGI:1194912 | Inparanoid, OMA |
Rat | 313048 | Rbbp4 | RB binding protein 4, chromatin remodeling factor | 10116 | RGD:1593768 | Inparanoid, OMA |
Dog | 478149 | RBBP4 | RB binding protein 4, chromatin remodeling factor | 9615 | VGNC:45391 | Inparanoid, OMA |
Horse | 100070175 | RBBP4 | RB binding protein 4, chromatin remodeling factor | 9796 | VGNC:22220 | Inparanoid, OMA |
Cow | 767940 | RBBP4 | RB binding protein 4, chromatin remodeling factor | 9913 | VGNC:33770 | Inparanoid, OMA |
Opossum | 100025905 | RBBP4 | RB binding protein 4, chromatin remodeling factor | 13616 | | Inparanoid, OMA |
Chicken | 395658 | RBBP4 | RB binding protein 4, chromatin remodeling factor | 9031 | CGNC:2572 | Inparanoid, OMA |
Anole lizard | 100561534 | rbbp4 | RB binding protein 4, chromatin remodeling factor | 28377 | | Inparanoid, OMA |
Xenopus | 496866 | rbbp4 | retinoblastoma binding protein 4 | 8364 | XB-GENE-482002 | Inparanoid, OMA |
Zebrafish | 321726 | rbbp4 | retinoblastoma binding protein 4 | 7955 | ZDB-GENE-030131-445 | Inparanoid, OMA |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|