RBBP4

DescriptionHistone-binding protein RBBP4

Gene and Protein Information

Gene ID5928
Uniprot Accession IDs B2R6G9 B4DRH0 D3DPQ3 P31149 Q53H02 Q96BV9
Ensembl ID ENSP00000362592
Symbol RBAP48 NURF55 RBAP48 lin-53
FamilyBelongs to the WD repeat RBAP46/RBAP48/MSI1 family.
Sequence
MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque708710RBBP4RB binding protein 4, chromatin remodeling factor9544Inparanoid, OMA
Mouse19646Rbbp4retinoblastoma binding protein 4, chromatin remodeling factor10090MGI:1194912Inparanoid, OMA
Rat313048Rbbp4RB binding protein 4, chromatin remodeling factor10116RGD:1593768Inparanoid, OMA
Dog478149RBBP4RB binding protein 4, chromatin remodeling factor9615VGNC:45391Inparanoid, OMA
Horse100070175RBBP4RB binding protein 4, chromatin remodeling factor9796VGNC:22220Inparanoid, OMA
Cow767940RBBP4RB binding protein 4, chromatin remodeling factor9913VGNC:33770Inparanoid, OMA
Opossum100025905RBBP4RB binding protein 4, chromatin remodeling factor13616Inparanoid, OMA
Chicken395658RBBP4RB binding protein 4, chromatin remodeling factor9031CGNC:2572Inparanoid, OMA
Anole lizard100561534rbbp4RB binding protein 4, chromatin remodeling factor28377Inparanoid, OMA
Xenopus496866rbbp4retinoblastoma binding protein 48364XB-GENE-482002Inparanoid, OMA
Zebrafish321726rbbp4retinoblastoma binding protein 47955ZDB-GENE-030131-445Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source