JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

NRAS

Description	GTPase NRas

Gene and Protein Information

Gene ID	4893
Uniprot Accession IDs	Q14971 Q15104 Q15282
Ensembl ID	ENSP00000358548
Symbol	HRAS1 NS6 CMNS NCMS ALPS4 N-ras NRAS1
Family	Belongs to the small GTPase superfamily. Ras family.
Sequence	MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	742713	NRAS	NRAS proto-oncogene, GTPase	9598	VGNC:10029	OMA, EggNOG
Macaque	709089	NRAS	NRAS proto-oncogene, GTPase	9544		Inparanoid, EggNOG
Mouse	18176	Nras	neuroblastoma ras oncogene	10090	MGI:97376	Inparanoid, OMA, EggNOG
Rat	24605	Nras	NRAS proto-oncogene, GTPase	10116	RGD:3205	Inparanoid, OMA
Dog	403872	NRAS	NRAS proto-oncogene, GTPase	9615	VGNC:43959	Inparanoid, OMA
Horse	100059469	NRAS	NRAS proto-oncogene, GTPase	9796	VGNC:20876	Inparanoid, OMA
Cow	506322	NRAS	NRAS proto-oncogene, GTPase	9913	VGNC:32253	Inparanoid, OMA, EggNOG
Opossum	554197	NRAS	NRAS proto-oncogene, GTPase	13616		Inparanoid, OMA, EggNOG
Chicken	419885	NRAS	neuroblastoma RAS viral oncogene homolog	9031	CGNC:51114	Inparanoid, OMA
Anole lizard	100565176	nras	NRAS proto-oncogene, GTPase	28377		Inparanoid, OMA
Anole lizard	100559807	LOC100559807	GTPase HRas	28377		OMA, EggNOG
Xenopus	493396	kras	Kirsten rat sarcoma viral oncogene homolog	8364	XB-GENE-6036229	OMA, EggNOG
Zebrafish	30380	nras	NRAS proto-oncogene, GTPase	7955	ZDB-GENE-990415-166	Inparanoid, OMA
C. elegans	178104	let-60	Ras protein let-60	6239		Inparanoid, OMA, EggNOG
Fruitfly	41140	Ras85D	Ras oncogene at 85D	7227	FBgn0003205	Inparanoid, OMA, EggNOG

PANTHER Classes
protein / enzyme modulator / small GTPase / GTPase NRas

DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / GTPase NRas

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source