JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

GTPase NRas

Gene ID	4893
uniprot	P01111
Gene Name	NRAS
Ensernbl ID	ENSP00000358548
Family	Belongs to the small GTPase superfamily. Ras family.
Sequence	MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	4893	NRAS	GTPase NRas	P01111
MOUSE		Nras	GTPase NRas	P08556
MOUSE	18176	Nras	Nras protein	Q4FJP3
MOUSE		Nras	GTPase NRas	A0A0G2JE25
MOUSE		Nras	Uncharacterized protein	Q3UCX0
MOUSE		Nras	GTPase NRas	A0A0G2JGP4
MOUSE	18176	Nras	Uncharacterized protein	Q3TMF4
MOUSE		Nras	GTPase NRas	A0A0G2JGM2
MOUSE		Nras	GTPase NRas	E9PVD5
MOUSE	18176	Nras	GTPase NRas	Q9D091
RAT	24605	Nras	GTPase NRas	Q04970

Protein Classes

PANTHER Classes
protein / enzyme modulator / small GTPase / GTPase NRas

DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / GTPase NRas

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx