JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Placenta growth factor

Gene ID	5228
uniprot	P49763
Gene Name	PGF
Ensernbl ID	ENSP00000451040
Family	Belongs to the PDGF/VEGF growth factor family.
Sequence	MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	5228	PGF	Placenta growth factor	P49763
MOUSE	18654	Pgf	Placenta growth factor	P49764
MOUSE	18654	Pgf	Uncharacterized protein	Q544A5
MOUSE		Pgf	Placenta growth factor	A0A1Y7VIW3
RAT	94203	Pgf	Placenta growth factor	Q63434

Protein Classes

PANTHER Classes
protein / signaling molecule / growth factor / Placenta growth factor

DTO Classes
protein / Signaling / Growth factor / Placenta growth factor

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx