The store will not work correctly when cookies are disabled.
PGF
Description | Placenta growth factor |
---|
Gene and Protein Information
Gene ID | 5228 |
Uniprot Accession IDs | Q07101 Q9BV78 Q9Y6S8 PlGF |
Ensembl ID | ENSP00000451040 |
Symbol | PGFL PLGF PGFL PIGF PLGF PlGF-2 D12S1900 SHGC-10760 |
Family | Belongs to the PDGF/VEGF growth factor family. |
Sequence | MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 741830 | PGF | placental growth factor | 9598 | VGNC:3348 | OMA, EggNOG |
Macaque | 701219 | PGF | placental growth factor | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 18654 | Pgf | placental growth factor | 10090 | MGI:105095 | Inparanoid, OMA, EggNOG |
Rat | 94203 | Pgf | placental growth factor | 10116 | RGD:619850 | Inparanoid, OMA, EggNOG |
Dog | 100855780 | PGF | placental growth factor | 9615 | VGNC:44457 | Inparanoid, OMA, EggNOG |
Horse | 100051349 | PGF | placental growth factor | 9796 | VGNC:21353 | Inparanoid, OMA, EggNOG |
Cow | 280894 | PGF | placental growth factor | 9913 | VGNC:32787 | Inparanoid, OMA, EggNOG |
Pig | | PGF | placental growth factor [Source:HGNC Symbol;Acc:HGNC:8893] | 9823 | | Inparanoid, OMA |
Opossum | 100023623 | PGF | placental growth factor | 13616 | | Inparanoid, EggNOG |
Platypus | | PGF | placental growth factor [Source:HGNC Symbol;Acc:HGNC:8893] | 9258 | | OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|