ELANE

Description	Neutrophil elastase

Gene and Protein Information

Gene ID	1991
Uniprot Accession IDs	P08246 P09649 Q6B0D9 Q6LDP5
Ensembl ID	ENSP00000466090
Symbol	ELA2 GE NE HLE HNE ELA2 SCN1 PMN-E
Family	Belongs to the peptidase S1 family. Elastase subfamily.
Sequence	MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	749897	ELANE	elastase, neutrophil expressed	9598		OMA, EggNOG
Macaque	106992354	ELANE	elastase, neutrophil expressed	9544		OMA, EggNOG
Mouse	50701	Elane	elastase, neutrophil expressed	10090	MGI:2679229	Inparanoid, OMA, EggNOG
Rat	299606	Elane	elastase, neutrophil expressed	10116	RGD:1307968	Inparanoid, OMA, EggNOG
Dog	442980	ELANE	elastase, neutrophil expressed	9615		Inparanoid, OMA, EggNOG
Cow	100126050	ELANE	elastase, neutrophil expressed	9913	VGNC:28423	Inparanoid, OMA, EggNOG
Pig	100522182	ELANE	elastase, neutrophil expressed	9823		OMA, EggNOG
Opossum	100030465	LOC100030465	neutrophil elastase	13616		Inparanoid, OMA, EggNOG
Xenopus	448597	prtn3	proteinase 3	8364	XB-GENE-5805214	OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    serine protease    /    Neutrophil elastase
protein    /    protease    /    Neutrophil elastase
protein    /    hydrolase    /    Neutrophil elastase

DTO Classes
protein / Enzyme / Protease / Serine protease / Neutrophil elastase

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Associated Antibodies

The page will load shortly, Thanks for your patience!

Name	Specifications	Species reactivity	Application	Availability	View Details

Related active small molecules

A total of 27 itemsPrev12 3 NextTopage

The page will load shortly, Thanks for your patience!

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Direct Associated Targets	Disease Type	Mondoid

Bibliography

A total of 262 itemsPrev12 3 4 5…27 NextTopage

1.Wakasugi, K K and Schimmel, P P. 1999-04-02 Two distinct cytokines released from a human aminoacyl-tRNA synthetase. [PMID:10102815]
2.Fujita, J J and 5 more authors. 1999-09 Modulation of elastase binding to elastin by human alveolar macrophage-derived lipids. [PMID:10471600]
3.Abts, H F HF and 5 more authors. 1999-10-15 Cloning and characterization of hurpin (protease inhibitor 13): A new skin-specific, UV-repressible serine proteinase inhibitor of the ovalbumin serpin family. [PMID:10512713]
4.Horwitz, M M, Benson, K F KF, Person, R E RE, Aprikyan, A G AG and Dale, D C DC. 1999-12 Mutations in ELA2, encoding neutrophil elastase, define a 21-day biological clock in cyclic haematopoiesis. [PMID:10581030]
5.Mulligan, M S MS and 7 more authors. 2000-03 Anti-inflammatory effects of mutant forms of secretory leukocyte protease inhibitor. [PMID:10702419]
6.Belaaouaj, A A AA, Li, A A, Wun, T C TC, Welgus, H G HG and Shapiro, S D SD. 2000-09-01 Matrix metalloproteinases cleave tissue factor pathway inhibitor. Effects on coagulation. [PMID:10859319]
7.Taggart, C C and 6 more authors. 2000-09-01 Oxidation of either methionine 351 or methionine 358 in alpha 1-antitrypsin causes loss of anti-neutrophil elastase activity. [PMID:10867014]
8.Perani, P P, Zeggai, S S, Torriglia, A A and Courtois, Y Y. 2000-08-11 Mutations on the hinge region of leukocyte elastase inhibitor determine the loss of inhibitory function. [PMID:10924364]
9.Dale, D C DC and 11 more authors. 2000-10-01 Mutations in the gene encoding neutrophil elastase in congenital and cyclic neutropenia. [PMID:11001877]
10.Sørensen, O E OE and 6 more authors. 2001-06-15 Human cathelicidin, hCAP-18, is processed to the antimicrobial peptide LL-37 by extracellular cleavage with proteinase 3. [PMID:11389039]