JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Gap junction beta-6 protein

Gene ID	10804
uniprot	O95452
Gene Name	GJB6
Ensernbl ID	ENSP00000348521
Family	Belongs to the connexin family. Beta-type (group I) subfamily.
Sequence	MDWGTLHTFIGGVNKHSTSIGKVWITVIFIFRVMILVVAAQEVWGDEQEDFVCNTLQPGCKNVCYDHFFPVSHIRLWALQLIFVSTPALLVAMHVAYYRHETTRKFRRGEKRNDFKDIEDIKKQKVRIEGSLWWTYTSSIFFRIIFEAAFMYVFYFLYNGYHLPWVLKCGIDPCPNLVDCFISRPTEKTVFTIFMISASVICMLLNVAELCYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFPS Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	10804	GJB6	Gap junction beta-6 protein	O95452
MOUSE	14623	Gjb6	Gap junction beta-6 protein	P70689
MOUSE		Gjb6	Gap junction beta-6 protein	E0CX48
MOUSE		Gjb6	Gap junction protein	Q3UYK0
MOUSE	14623	Gjb6	Gap junction protein	Q3URC5
RAT	84403	Gjb6	Gap junction protein	Q9R140
RAT	84403	Gjb6	Gap junction protein	Q6AZ42

Protein Classes

PANTHER Classes
protein / cell junction protein / gap junction / Gap junction beta-6 protein

DTO Classes
protein / Cell-cell junction / Gap junction / Gap junction beta-6 protein

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx