The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
PEX19
| Description | Peroxisomal biogenesis factor 19 |
|---|
Gene and Protein Information
| Gene ID | 5824 |
|---|
| Uniprot Accession IDs | P40855 D3DVE7 Q5QNY4 Q8NI97 |
|---|
| Ensembl ID | ENSP00000357051 |
|---|
| Symbol | HK33 PXF PXF HK33 PMP1 PMPI PXMP1 PBD12A D1S2223E |
|---|
| Family | Belongs to the peroxin-19 family. |
|---|
| Sequence | MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQCLIM |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 746746 | PEX19 | peroxisomal biogenesis factor 19 | 9598 | VGNC:1447 | OMA, EggNOG |
| Mouse | 19298 | Pex19 | peroxisomal biogenesis factor 19 | 10090 | MGI:1334458 | Inparanoid, OMA, EggNOG |
| Rat | 100911356 | LOC100911356 | peroxisomal biogenesis factor 19-like | 10116 | RGD:6493558 | Inparanoid, OMA |
| Dog | 478972 | PEX19 | peroxisomal biogenesis factor 19 | 9615 | VGNC:44432 | Inparanoid, OMA, EggNOG |
| Horse | 100058470 | PEX19 | peroxisomal biogenesis factor 19 | 9796 | VGNC:21326 | Inparanoid, OMA, EggNOG |
| Cow | 521522 | PEX19 | peroxisomal biogenesis factor 19 | 9913 | VGNC:32758 | Inparanoid, OMA, EggNOG |
| Pig | 100154884 | PEX19 | peroxisomal biogenesis factor 19 | 9823 | | OMA, EggNOG |
| Opossum | 100029711 | PEX19 | peroxisomal biogenesis factor 19 | 13616 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100145099 | pex19 | peroxisomal biogenesis factor 19 | 8364 | XB-GENE-973478 | Inparanoid, OMA, EggNOG |
| Zebrafish | 324778 | pex19 | peroxisomal biogenesis factor 19 | 7955 | ZDB-GENE-050417-424 | Inparanoid, OMA, EggNOG |
| C. elegans | 176239 | prx-19 | Putative peroxisomal biogenesis factor 19 | 6239 | | Inparanoid, OMA, EggNOG |
| Fruitfly | 34630 | Pex19 | Peroxin 19 | 7227 | FBgn0032407 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes protein /
storage protein / Peroxisomal biogenesis factor 19
DTO Classes protein /
Storage / Peroxisomal biogenesis factor 19
Associated Recombinant Proteins
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
The page will load shortly, Thanks for your patience!
