JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Peroxisomal biogenesis factor 19

Gene ID	5824
uniprot	P40855
Gene Name	PEX19
Ensernbl ID	ENSP00000357051
Family	Belongs to the peroxin-19 family.
Sequence	MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQCLIM Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	5824	PEX19	Peroxisomal biogenesis factor 19	P40855
MOUSE		Pex19	Peroxisome biogenesis factor 19, isoform CRA_e	Q3TDI5
MOUSE	19298	Pex19	Peroxisomal biogenesis factor 19	Q8VCI5
RAT	289233	Pex19	Peroxisomal biogenesis factor 19	A0A0G2JY69
RAT		Pex19	Peroxisomal biogenesis factor 19	Q9QYU1

Protein Classes

PANTHER Classes
protein / storage protein / Peroxisomal biogenesis factor 19

DTO Classes
protein / Storage / Peroxisomal biogenesis factor 19

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx