JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Ras-related protein Ral-A

Gene ID	5898
uniprot	P11233
Gene Name	RALA
Ensernbl ID	ENSP00000005257
Family	Belongs to the small GTPase superfamily. Ras family.
Sequence	MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	5898	RALA	Ras-related protein Ral-A	P11233
MOUSE		Rala	Ras-related protein Ral-A	A0A1Y7VL93
MOUSE		Rala	Uncharacterized protein	Q9CXY0
MOUSE	56044	Rala	Ras-related protein Ral-A	P63321
RAT	81757	Rala	Ras-related protein Ral-A	P63322

Protein Classes

PANTHER Classes
protein / enzyme modulator / small GTPase / Ras-related protein Ral-A

DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / Ras-related protein Ral-A

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: TCRDv6_DataSourcesLicenses.xlsx