The store will not work correctly when cookies are disabled.
PHB
Gene and Protein Information
| Gene ID | 5245 |
|---|
| Uniprot Accession IDs | B4DY47 Q4VBQ0 |
|---|
| Ensembl ID | ENSP00000479488 |
|---|
| Symbol | PHB1 HEL-215 HEL-S-54e |
|---|
| Family | Belongs to the prohibitin family. |
|---|
| Sequence | MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 455205 | PHB | prohibitin | 9598 | VGNC:9514 | OMA, EggNOG |
| Macaque | 699334 | PHB | prohibitin | 9544 | | OMA, EggNOG |
| Mouse | 18673 | Phb | prohibitin | 10090 | MGI:97572 | Inparanoid, OMA, EggNOG |
| Rat | 25344 | Phb | prohibitin | 10116 | RGD:3322 | Inparanoid, OMA, EggNOG |
| Dog | 480547 | PHB | prohibitin | 9615 | | Inparanoid, OMA, EggNOG |
| Horse | 100056039 | PHB | prohibitin | 9796 | VGNC:21368 | Inparanoid, OMA, EggNOG |
| Cow | 530409 | PHB | prohibitin | 9913 | VGNC:32808 | Inparanoid, OMA, EggNOG |
| Pig | 100524707 | PHB | prohibitin | 9823 | | OMA, EggNOG |
| Opossum | 100618482 | PHB | prohibitin | 13616 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100564329 | phb | prohibitin | 28377 | | OMA, EggNOG |
| Xenopus | 394635 | phb | prohibitin | 8364 | XB-GENE-977670 | Inparanoid, OMA, EggNOG |
| Zebrafish | 321346 | phb | prohibitin | 7955 | ZDB-GENE-030131-6577 | Inparanoid, OMA |
| C. elegans | 171768 | phb-1 | Mitochondrial prohibitin complex protein 1 | 6239 | | Inparanoid, OMA |
| Fruitfly | 49168 | l(2)37Cc | lethal (2) 37Cc | 7227 | FBgn0002031 | Inparanoid, EggNOG |
| S.cerevisiae | 853033 | PHB1 | prohibitin subunit PHB1 | 4932 | S000003364 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
