Click Here for 5% Off Your First Aladdin Purchase!
Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

Protein or Target Summary

Phosphatidylinositol-glycan biosynthesis class X protein

Gene ID54965
uniprotQ8TBF5
Gene NamePIGX
Ensernbl IDENSP00000296333
FamilyBelongs to the PIGX family.
Sequence
MAARVAAVRAAAWLLLGAATGLTRGPAAAFTAARSDAGIRAMCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQEFPILKCWAHSEVAAPCALENEDICQWNKMKYKSVYKNVILQVPVGLTVHTSLVCSVTLLITILCSTLILVAVFKYGHFSL
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN54965PIGXPhosphatidylinositol-glycan biosynthesis class X proteinQ8TBF5
MOUSEPigxPhosphatidylinositol-glycan biosynthesis class X proteinF6RUP6
MOUSEPigxPhosphatidylinositol-glycan biosynthesis class X proteinF6XTT6
MOUSEPigxPhosphatidylinositol-glycan biosynthesis class X proteinF6YX19
MOUSEPigxPhosphatidylinositol-glycan biosynthesis class X proteinF7CUX5
MOUSEPigxPhosphatidylinositol-glycan biosynthesis class X proteinF6WL03
MOUSEPigxPhosphatidylinositol-glycan biosynthesis class X proteinF6QPF7
MOUSE72084PigxPhosphatidylinositol-glycan biosynthesis class X proteinA0A087WSN5
MOUSEPigxPhosphatidylinositol-glycan biosynthesis class X proteinF7DFD7
MOUSE72084PigxPhosphatidylinositol-glycan biosynthesis class X proteinQ99LV7
RATPigxPhosphatidylinositol-glycan biosynthesis class X proteinF1LRM6
RAT288041PigxPhosphatidylinositol-glycan biosynthesis class X proteinQ60GF7

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      Source: DataSourcesLicenses.xlsx
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.