Protein or Target Summary

Proliferating cell nuclear antigen

Gene ID	5111
uniprot	P12004
Gene Name	PCNA
Ensernbl ID	ENSP00000368458
Family	Belongs to the PCNA family.
Sequence	MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	5111	PCNA	Proliferating cell nuclear antigen	P12004
MOUSE		Pcna	Proliferating cell nuclear antigen	Q9CZD6
MOUSE		Pcna	Proliferating cell nuclear antigen	Q91ZH2
MOUSE	18538	Pcna	Proliferating cell nuclear antigen	Q542J9
MOUSE	18538	Pcna	Proliferating cell nuclear antigen	P17918
RAT	25737	Pcna	Proliferating cell nuclear antigen	P04961

Protein Classes

PANTHER Classes
protein / nucleic acid binding / DNA polymerase processivity factor / Proliferating cell nuclear antigen

DTO Classes
protein / Nucleic acid binding / DNA binding protein / DNA polymerase processivity factor / Proliferating cell nuclear antigen

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: TCRDv6_DataSourcesLicenses.xlsx