PCNA

Description	Proliferating cell nuclear antigen

Gene and Protein Information

Gene ID	5111
Uniprot Accession IDs	B2R897 D3DW02 PCNA
Ensembl ID	ENSP00000368458
Symbol	ATLD2
Family	Belongs to the PCNA family.
Sequence	MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	458081	PCNA	proliferating cell nuclear antigen	9598	VGNC:6229	OMA, EggNOG
Macaque	718006	PCNA	proliferating cell nuclear antigen	9544		Inparanoid, OMA, EggNOG
Mouse	18538	Pcna	proliferating cell nuclear antigen	10090	MGI:97503	OMA, EggNOG
Mouse	18540	Pcna-ps2	proliferating cell nuclear antigen pseudogene 2	10090	MGI:97505	Inparanoid, OMA
Rat	25737	Pcna	proliferating cell nuclear antigen	10116	RGD:3269	Inparanoid, OMA, EggNOG
Dog	477166	PCNA	proliferating cell nuclear antigen	9615	VGNC:44310	Inparanoid, OMA, EggNOG
Horse	100052065	PCNA	proliferating cell nuclear antigen	9796	VGNC:21207	Inparanoid, OMA, EggNOG
Cow	515499	PCNA	proliferating cell nuclear antigen	9913	VGNC:32635	Inparanoid, OMA, EggNOG
Pig	692192	PCNA	proliferating cell nuclear antigen	9823		Inparanoid, OMA, EggNOG
Opossum	100029293	PCNA	proliferating cell nuclear antigen	13616		Inparanoid, EggNOG
Anole lizard	100560949	pcna	proliferating cell nuclear antigen	28377		Inparanoid, OMA, EggNOG
Xenopus	493302	pcna	proliferating cell nuclear antigen	8364	XB-GENE-972522	Inparanoid, OMA, EggNOG
Zebrafish	30678	pcna	proliferating cell nuclear antigen	7955	ZDB-GENE-000210-8	Inparanoid, OMA, EggNOG
C. elegans	177161	pcn-1	Proliferating cell nuclear antigen	6239		Inparanoid, OMA
Fruitfly	37290	PCNA	Proliferating cell nuclear antigen	7227	FBgn0005655	Inparanoid, OMA, EggNOG
S.cerevisiae	852385	POL30	proliferating cell nuclear antigen	4932	S000000292	Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein / nucleic acid binding / DNA polymerase processivity factor / Proliferating cell nuclear antigen

DTO Classes
protein / Nucleic acid binding / DNA binding protein / DNA polymerase processivity factor / Proliferating cell nuclear antigen

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]