Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

PCNA

DescriptionProliferating cell nuclear antigen

Gene and Protein Information

Gene ID5111
Uniprot Accession IDs B2R897 D3DW02 PCNA
Ensembl ID ENSP00000368458
Symbol ATLD2
FamilyBelongs to the PCNA family.
Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp458081PCNAproliferating cell nuclear antigen9598VGNC:6229OMA, EggNOG
Macaque718006PCNAproliferating cell nuclear antigen9544Inparanoid, OMA, EggNOG
Mouse18538Pcnaproliferating cell nuclear antigen10090MGI:97503OMA, EggNOG
Mouse18540Pcna-ps2proliferating cell nuclear antigen pseudogene 210090MGI:97505Inparanoid, OMA
Rat25737Pcnaproliferating cell nuclear antigen10116RGD:3269Inparanoid, OMA, EggNOG
Dog477166PCNAproliferating cell nuclear antigen9615VGNC:44310Inparanoid, OMA, EggNOG
Horse100052065PCNAproliferating cell nuclear antigen9796VGNC:21207Inparanoid, OMA, EggNOG
Cow515499PCNAproliferating cell nuclear antigen9913VGNC:32635Inparanoid, OMA, EggNOG
Pig692192PCNAproliferating cell nuclear antigen9823Inparanoid, OMA, EggNOG
Opossum100029293PCNAproliferating cell nuclear antigen13616Inparanoid, EggNOG
Anole lizard100560949pcnaproliferating cell nuclear antigen28377Inparanoid, OMA, EggNOG
Xenopus493302pcnaproliferating cell nuclear antigen8364XB-GENE-972522Inparanoid, OMA, EggNOG
Zebrafish30678pcnaproliferating cell nuclear antigen7955ZDB-GENE-000210-8Inparanoid, OMA, EggNOG
C. elegans177161pcn-1Proliferating cell nuclear antigen6239Inparanoid, OMA
Fruitfly37290PCNAProliferating cell nuclear antigen7227FBgn0005655Inparanoid, OMA, EggNOG
S.cerevisiae852385POL30proliferating cell nuclear antigen4932S000000292Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA polymerase processivity factor    /    Proliferating cell nuclear antigen
DTO Classes
protein    /    Nucleic acid binding    /    DNA binding protein    /    DNA polymerase processivity factor    /    Proliferating cell nuclear antigen

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.