Protein or Target Summary
Pyridoxal kinase
| Gene ID | 8566 |
|---|---|
| uniprot | O00764 |
| Gene Name | PDXK |
| Ensernbl ID | ENSP00000291565 |
| Family | Belongs to the pyridoxine kinase family. |
| Sequence | MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL Show more |
Gene and Protein Information
Protein Classes
DTO Classes
protein / Kinase / Non-protein kinase / Other small molecule kinase / Pyridoxine kinase family / Pyridoxal kinase
protein / Kinase / Non-protein kinase / Other small molecule kinase / Pyridoxine kinase family / Pyridoxal kinase
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx