The store will not work correctly when cookies are disabled.
SERPINF1
| Description | Pigment epithelium-derived factor |
|---|
Gene and Protein Information
| Gene ID | 5176 |
|---|
| Uniprot Accession IDs | F1T092 Q13236 Q2TU83 Q96CT1 Q96R01 Q9BWA4 PEDF |
|---|
| Ensembl ID | ENSP00000254722 |
|---|
| Symbol | PEDF OI6 OI12 PEDF EPC-1 PIG35 |
|---|
| Family | Belongs to the serpin family. |
|---|
| Sequence | MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 468137 | SERPINF1 | serpin family F member 1 | 9598 | VGNC:10074 | OMA, EggNOG |
| Mouse | 20317 | Serpinf1 | serine (or cysteine) peptidase inhibitor, clade F, member 1 | 10090 | MGI:108080 | Inparanoid, OMA, EggNOG |
| Rat | 287526 | Serpinf1 | serpin family F member 1 | 10116 | RGD:631369 | Inparanoid, OMA, EggNOG |
| Dog | 611276 | SERPINF1 | serpin family F member 1 | 9615 | VGNC:46039 | Inparanoid, OMA, EggNOG |
| Horse | 100072415 | SERPINF1 | serpin family F member 1 | 9796 | VGNC:22859 | Inparanoid, OMA, EggNOG |
| Cow | 281386 | SERPINF1 | serpin family F member 1 | 9913 | VGNC:34478 | Inparanoid, OMA, EggNOG |
| Pig | 780402 | SERPINF1 | serpin family F member 1 | 9823 | | OMA, EggNOG |
| Opossum | 100018306 | SERPINF1 | serpin family F member 1 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | | SERPINF1 | serpin family F member 1 [Source:HGNC Symbol;Acc:HGNC:8824] | 9258 | | OMA, EggNOG |
| Chicken | 417561 | SERPINF1 | serpin family F member 1 | 9031 | CGNC:2160 | Inparanoid, OMA, EggNOG |
| Anole lizard | | SERPINF1 | serpin family F member 1 [Source:HGNC Symbol;Acc:HGNC:8824] | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 394686 | serpinf1 | serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 | 8364 | XB-GENE-945026 | Inparanoid, OMA, EggNOG |
| Zebrafish | 447800 | serpinf1 | serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 | 7955 | ZDB-GENE-040912-2 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
