The store will not work correctly when cookies are disabled.
NDUFA4
| Description | Cytochrome c oxidase subunit NDUFA4 |
|---|
Gene and Protein Information
| Gene ID | 4697 |
|---|
| Uniprot Accession IDs | A4D109 Q6FHN5 |
|---|
| Ensembl ID | ENSP00000339720 |
|---|
| Symbol | MLRQ CI-9k COXFA4 CI-MLRQ |
|---|
| Family | Belongs to the complex IV NDUFA4 subunit family. |
|---|
| Sequence | MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Mouse | 17992 | Ndufa4 | Ndufa4, mitochondrial complex associated | 10090 | MGI:107686 | Inparanoid, OMA, EggNOG |
| Rat | 681024 | Ndufa4 | NDUFA4, mitochondrial complex associated | 10116 | RGD:1584719 | Inparanoid, OMA, EggNOG |
| Horse | | NDUFA4 | NDUFA4, mitochondrial complex associated [Source:HGNC Symbol;Acc:HGNC:7687] | 9796 | | OMA, EggNOG |
| Cow | 327704 | NDUFA4 | NDUFA4, mitochondrial complex associated | 9913 | VGNC:31947 | Inparanoid, OMA, EggNOG |
| Pig | 100579141 | NDUFA4 | NDUFA4, mitochondrial complex associated | 9823 | | OMA, EggNOG |
| Opossum | 100025610 | NDUFA4 | NDUFA4, mitochondrial complex associated | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 772135 | NDUFA4 | NDUFA4, mitochondrial complex associated | 9031 | CGNC:66679 | Inparanoid, OMA |
| Zebrafish | 406298 | ndufa4 | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4 | 7955 | ZDB-GENE-040426-1962 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes protein /
oxidoreductase / Cytochrome c oxidase subunit NDUFA4
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
