Protein or Target Summary
Dynein light chain 1, cytoplasmic
| Gene ID | 8655 |
|---|---|
| uniprot | P63167 |
| Gene Name | DYNLL1 |
| Ensernbl ID | ENSP00000376297 |
| Family | Belongs to the dynein light chain family. |
| Sequence | MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG Show more |
Gene and Protein Information
Protein Classes
PANTHER Classes
protein / cytoskeletal protein / microtubule family cytoskeletal protein / Dynein light chain 1, cytoplasmic
protein / cytoskeletal protein / enzyme modulator / Dynein light chain 1, cytoplasmic
protein / cytoskeletal protein / microtubule family cytoskeletal protein / Dynein light chain 1, cytoplasmic
protein / cytoskeletal protein / enzyme modulator / Dynein light chain 1, cytoplasmic
DTO Classes
protein / Cellular structure / Microtubule family cytoskeletal protein / Dynein light chain 1, cytoplasmic
protein / Cellular structure / Microtubule family cytoskeletal protein / Dynein light chain 1, cytoplasmic
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: TCRDv6_DataSourcesLicenses.xlsx