JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

RGS19

Description	Regulator of G-protein signaling 19

Gene and Protein Information

Gene ID	10287
Uniprot Accession IDs	A8K216 E1P5G9 Q53XN0 Q8TD60 RGS19
Ensembl ID	ENSP00000378483
Symbol	GAIP GNAI3IP GAIP RGSGAIP
Sequence	MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	56470	Rgs19	regulator of G-protein signaling 19	10090	MGI:1915153	Inparanoid, OMA, EggNOG
Rat	59293	Rgs19	regulator of G-protein signaling 19	10116	RGD:629471	Inparanoid, OMA, EggNOG
Dog	491407	RGS19	regulator of G protein signaling 19	9615	VGNC:45528	Inparanoid, OMA, EggNOG
Horse	100051702	RGS19	regulator of G protein signaling 19	9796	VGNC:22347	Inparanoid, OMA, EggNOG
Cow	539036	RGS19	regulator of G protein signaling 19	9913	VGNC:33918	Inparanoid, OMA, EggNOG
Opossum	100019127	RGS19	regulator of G protein signaling 19	13616		Inparanoid, EggNOG
Anole lizard	100562817	rgs19	regulator of G protein signaling 19	28377		Inparanoid, OMA, EggNOG
Xenopus	100145150	rgs19	regulator of G-protein signaling 19	8364	XB-GENE-5736048	OMA, EggNOG

PANTHER Classes
protein / enzyme modulator / G-protein modulator / Regulator of G-protein signaling 19

DTO Classes
protein / Enzyme modulator / G-protein modulator / Regulator of G-protein signaling 19

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source