JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Regulator of G-protein signaling 19

Gene ID	10287
uniprot	P49795
Gene Name	RGS19
Ensernbl ID	ENSP00000378483
Sequence	MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	10287	RGS19	Regulator of G-protein signaling 19	P49795
MOUSE	56470	Rgs19	Regulator of G-protein-signaling 19	B7ZCT1
MOUSE		Rgs19	Regulator of G-protein-signaling 19	B7ZCT0
MOUSE		Rgs19	GAIP/RGS19, short isoform	Q8CGT5
MOUSE		Rgs19	Uncharacterized protein	Q9CTC4
MOUSE		Rgs19	Regulator of G-protein-signaling 19	F6WK59
MOUSE		Rgs19	Regulator of G-protein-signaling 19	B7ZCS8
MOUSE	56470	Rgs19	GAIP/RGS19 short isoform	Q8BFU4
MOUSE	56470	Rgs19	GAIP/RGS19	Q78NN4
MOUSE	56470	Rgs19	Regulator of G-protein signaling 19	Q9CX84
RAT	59293	Rgs19	Regulator of G-protein signaling 19	O70521

Protein Classes

PANTHER Classes
protein / enzyme modulator / G-protein modulator / Regulator of G-protein signaling 19

DTO Classes
protein / Enzyme modulator / G-protein modulator / Regulator of G-protein signaling 19

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx