| Description | Dual specificity tyrosine-phosphorylation-regulated kinase 4 |
|---|
Gene and Protein Information
| Gene ID | 8798 |
|---|---|
| Uniprot Accession IDs | A8K8F7 Q8NEF2 Q92631 |
| Ensembl ID | ENSP00000441755 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MNB/DYRK subfamily. |
| Sequence | MPASELKASEIPFHPSIKTQDPKAEEKSPKKQKVTLTAAEALKLFKNQLSPYEQSEILGYAELWFLGLEAKKLDTAPEKFSKTSFDDEHGFYLKVLHDHIAYRYEVLETIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHQQALMELKILEALRKKDKDNTYNVVHMKDFFYFRNHFCITFELLGINLYELMKNNNFQGFSLSIVRRFTLSVLKCLQMLSVEKIIHCDLKPENIVLYQKGQASVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYDVAIDMWSLGCITAELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLKTYDTSFLDFLRRCLVWEPSLRMTPDQALKHAWIHQSRNLKPQPRPQTLRKSNSFFPSETRKDKVQGCHHSSRKADEITKETTEKTKDSPTKHVQHSGDQQDCLQHGADTVQLPQLVDAPKKSEAAVGAEVSMTSPGQSKNFSLKNTNVLPPIV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 466926 | DYRK4 | dual specificity tyrosine phosphorylation regulated kinase 4 | 9598 | VGNC:8403 | OMA, EggNOG |
| Macaque | 710999 | DYRK4 | dual specificity tyrosine phosphorylation regulated kinase 4 | 9544 | OMA, EggNOG | |
| Mouse | 101320 | Dyrk4 | dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 | 10090 | MGI:1330292 | Inparanoid, OMA, EggNOG |
| Rat | 312721 | Dyrk4 | dual specificity tyrosine phosphorylation regulated kinase 4 | 10116 | RGD:1306800 | Inparanoid, OMA |
| Dog | 477720 | DYRK4 | dual specificity tyrosine phosphorylation regulated kinase 4 | 9615 | Inparanoid, EggNOG | |
| Horse | 100058544 | DYRK4 | dual specificity tyrosine phosphorylation regulated kinase 4 | 9796 | Inparanoid, OMA, EggNOG | |
| Cow | 531276 | DYRK4 | dual specificity tyrosine phosphorylation regulated kinase 4 | 9913 | OMA, EggNOG | |
| Pig | 100524805 | DYRK4 | dual specificity tyrosine phosphorylation regulated kinase 4 | 9823 | OMA, EggNOG | |
| Opossum | 100019452 | DYRK4 | dual specificity tyrosine phosphorylation regulated kinase 4 | 13616 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 564976 | dyrk4 | dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 | 7955 | ZDB-GENE-091015-3 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / protein kinase / Dual specificity tyrosine-phosphorylation-regulated kinase 4
protein / non-receptor serine/threonine protein kinase / Dual specificity tyrosine-phosphorylation-regulated kinase 4
protein / non-receptor tyrosine protein kinase / Dual specificity tyrosine-phosphorylation-regulated kinase 4
protein / transferase / Dual specificity tyrosine-phosphorylation-regulated kinase 4
protein / kinase / Dual specificity tyrosine-phosphorylation-regulated kinase 4
protein / protein kinase / Dual specificity tyrosine-phosphorylation-regulated kinase 4
protein / non-receptor serine/threonine protein kinase / Dual specificity tyrosine-phosphorylation-regulated kinase 4
protein / non-receptor tyrosine protein kinase / Dual specificity tyrosine-phosphorylation-regulated kinase 4
protein / transferase / Dual specificity tyrosine-phosphorylation-regulated kinase 4
protein / kinase / Dual specificity tyrosine-phosphorylation-regulated kinase 4
DTO Classes
protein / Kinase / Protein kinase / CMGC group / DYRK family / Dyrk2 subfamily / Dual specificity tyrosine-phosphorylation-regulated kinase 4
protein / Kinase / Protein kinase / CMGC group / DYRK family / Dyrk2 subfamily / Dual specificity tyrosine-phosphorylation-regulated kinase 4
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|