RGS17

Description	Regulator of G-protein signaling 17

Gene and Protein Information

Gene ID	26575
Uniprot Accession IDs	Q5TF49 Q8TD61 Q9UJS8 RGS17
Ensembl ID	ENSP00000356194
Symbol	RGSZ2 RGSZ2 RGS-17 hRGS17
Sequence	MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	737204	RGS17	regulator of G protein signaling 17	9598	VGNC:11204	OMA, EggNOG
Macaque	100429275	RGS17	regulator of G protein signaling 17	9544		OMA, EggNOG
Mouse	56533	Rgs17	regulator of G-protein signaling 17	10090	MGI:1927469	Inparanoid, OMA, EggNOG
Rat	308118	Rgs17	regulator of G-protein signaling 17	10116	RGD:1305515	Inparanoid, OMA, EggNOG
Dog	608867	RGS17	regulator of G protein signaling 17	9615	VGNC:45526	Inparanoid, OMA, EggNOG
Horse	100060098	RGS17	regulator of G protein signaling 17	9796	VGNC:22345	Inparanoid, OMA, EggNOG
Cow	504255	RGS17	regulator of G protein signaling 17	9913	VGNC:33916	Inparanoid, OMA, EggNOG
Pig	100514020	RGS17	regulator of G protein signaling 17	9823		OMA, EggNOG
Opossum	100027291	RGS17	regulator of G protein signaling 17	13616		Inparanoid, OMA, EggNOG
Platypus		RGS17	regulator of G protein signaling 17 [Source:HGNC Symbol;Acc:HGNC:14088]	9258		OMA, EggNOG
Chicken	395645	RGS17	regulator of G-protein signaling 17	9031	CGNC:66208	Inparanoid, OMA
Anole lizard	100558841	rgs17	regulator of G protein signaling 17	28377		Inparanoid, OMA, EggNOG
Xenopus		rgs17	regulator of G-protein signaling 17 [Source:Xenbase;Acc:XB-GENE-984104]	8364		OMA, EggNOG

PANTHER Classes
protein / enzyme modulator / G-protein modulator / Regulator of G-protein signaling 17

DTO Classes
protein / Enzyme modulator / G-protein modulator / Regulator of G-protein signaling 17

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source