The store will not work correctly when cookies are disabled.
Protein or Target Summary
Regulator of G-protein signaling 17
Gene ID | 26575 |
uniprot | Q9UGC6 |
Gene Name | RGS17 |
Ensernbl ID | ENSP00000356194 |
Sequence | MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES Show more |
---|
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|
HUMAN | 26575 | RGS17 | Regulator of G-protein signaling 17 | Q9UGC6 |
MOUSE | | Rgs17 | Regulator of G-protein signaling 17 | Q6P208 |
MOUSE | | Rgs17 | Regulator of G-protein-signaling 17 | F8WH97 |
MOUSE | 56533 | Rgs17 | Uncharacterized protein | Q8BR34 |
MOUSE | | Rgs17 | Uncharacterized protein | Q8C5F3 |
MOUSE | 56533 | Rgs17 | Regulator of G-protein signaling 17, isoform CRA_b | G5E8E0 |
MOUSE | 56533 | Rgs17 | Regulator of G-protein signaling 17 | Q9QZB0 |
RAT | 308118 | Rgs17 | Regulator of G-protein signaling 17 (Predicted), isoform CRA_a | F1M0G0 |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|