JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Regulator of G-protein signaling 17

Gene ID	26575
uniprot	Q9UGC6
Gene Name	RGS17
Ensernbl ID	ENSP00000356194
Sequence	MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	26575	RGS17	Regulator of G-protein signaling 17	Q9UGC6
MOUSE		Rgs17	Regulator of G-protein signaling 17	Q6P208
MOUSE		Rgs17	Regulator of G-protein-signaling 17	F8WH97
MOUSE	56533	Rgs17	Uncharacterized protein	Q8BR34
MOUSE		Rgs17	Uncharacterized protein	Q8C5F3
MOUSE	56533	Rgs17	Regulator of G-protein signaling 17, isoform CRA_b	G5E8E0
MOUSE	56533	Rgs17	Regulator of G-protein signaling 17	Q9QZB0
RAT	308118	Rgs17	Regulator of G-protein signaling 17 (Predicted), isoform CRA_a	F1M0G0

Protein Classes

PANTHER Classes
protein / enzyme modulator / G-protein modulator / Regulator of G-protein signaling 17

DTO Classes
protein / Enzyme modulator / G-protein modulator / Regulator of G-protein signaling 17

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx