JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Regulator of G-protein signaling 4

Gene ID	5999
uniprot	P49798
Gene Name	RGS4
Ensernbl ID	ENSP00000397181
Sequence	MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	5999	RGS4	Regulator of G-protein signaling 4	P49798
MOUSE		Rgs4	Regulator of G-protein-signaling 4	D3YXR2
MOUSE	19736	Rgs4	Regulator of G-protein signaling 4	Q5D078
MOUSE	19736	Rgs4	Regulator of G-protein signaling 4	O08899
RAT	29480	Rgs4	Regulator of G-protein signaling 4	P49799

Protein Classes

PANTHER Classes
protein / enzyme modulator / G-protein modulator / Regulator of G-protein signaling 4

DTO Classes
protein / Enzyme modulator / G-protein modulator / Regulator of G-protein signaling 4

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx