The store will not work correctly when cookies are disabled.
Protein or Target Summary
Regulator of G-protein signaling 4
Gene ID | 5999 |
uniprot | P49798 |
Gene Name | RGS4 |
Ensernbl ID | ENSP00000397181 |
Sequence | MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA Show more |
---|
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|
HUMAN | 5999 | RGS4 | Regulator of G-protein signaling 4 | P49798 |
MOUSE | | Rgs4 | Regulator of G-protein-signaling 4 | D3YXR2 |
MOUSE | 19736 | Rgs4 | Regulator of G-protein signaling 4 | Q5D078 |
MOUSE | 19736 | Rgs4 | Regulator of G-protein signaling 4 | O08899 |
RAT | 29480 | Rgs4 | Regulator of G-protein signaling 4 | P49799 |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|