The store will not work correctly when cookies are disabled.
GCSAM
| Description | Germinal center-associated signaling and motility protein |
|---|
Gene and Protein Information
| Gene ID | 257144 |
|---|
| Uniprot Accession IDs | C9JD17 C9JUG6 |
|---|
| Ensembl ID | ENSP00000419485 |
|---|
| Symbol | GAL GCET2 HGAL GCAT2 GCET2 |
|---|
| Sequence | MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 460581 | GCSAM | germinal center associated signaling and motility | 9598 | VGNC:9673 | OMA, EggNOG |
| Macaque | 707891 | GCSAM | germinal center associated signaling and motility | 9544 | | OMA, EggNOG |
| Mouse | 14525 | Gcsam | germinal center associated, signaling and motility | 10090 | MGI:102969 | Inparanoid, OMA, EggNOG |
| Rat | 685692 | Gcsam | germinal center-associated, signaling and motility | 10116 | RGD:1591321 | Inparanoid, OMA, EggNOG |
| Dog | 100684299 | GCSAM | germinal center associated signaling and motility | 9615 | VGNC:41152 | Inparanoid, OMA, EggNOG |
| Horse | | GCSAM | germinal center associated signaling and motility [Source:HGNC Symbol;Acc:HGNC:20253] | 9796 | | OMA, EggNOG |
| Cow | 784939 | GCSAM | germinal center associated signaling and motility | 9913 | VGNC:29293 | OMA, EggNOG |
| Pig | 100626350 | GCSAM | germinal center associated signaling and motility | 9823 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
