The store will not work correctly when cookies are disabled.
Protein or Target Summary
Germinal center-associated signaling and motility protein
| Gene ID | 257144 |
|---|
| uniprot | Q8N6F7 |
|---|
| Gene Name | GCSAM |
|---|
| Ensernbl ID | ENSP00000419485 |
|---|
| Sequence | MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 257144 | GCSAM | Germinal center-associated signaling and motility protein | Q8N6F7 |
| MOUSE | 14525 | Gcsam | Germinal center-associated signaling and motility protein | Q6RFH4 |
| RAT | 685692 | Gcsam | Germinal center-associated,-signaling and motility | D3ZLK1 |
| RAT | 685692 | Gcsam | Germinal center-associated,-signaling and motility | A0A1W2Q6E0 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
