The store will not work correctly when cookies are disabled.
Protein or Target Summary
E3 ubiquitin-protein ligase RING2
| Gene ID | 6045 |
|---|
| uniprot | Q99496 |
|---|
| Gene Name | RNF2 |
|---|
| Ensernbl ID | ENSP00000356480 |
|---|
| Sequence | MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 6045 | RNF2 | E3 ubiquitin-protein ligase RING2 | Q99496 |
| MOUSE | | Rnf2 | E3 ubiquitin-protein ligase RING2 | A0A087WQQ3 |
| MOUSE | | Rnf2 | E3 ubiquitin-protein ligase RING2 | A0A087WRE9 |
| MOUSE | | Rnf2 | E3 ubiquitin-protein ligase RING2 | A0A087WP87 |
| MOUSE | 19821 | Rnf2 | E3 ubiquitin-protein ligase RING2 | Q9CQJ4 |
| RAT | 304850 | Rnf2 | Ring finger protein 2 | M5AJY0 |
| RAT | 304850 | Rnf2 | E3 ubiquitin-protein ligase RING2 | A0A0G2JTP7 |
| RAT | 304850 | Rnf2 | E3 ubiquitin-protein ligase RING2 | Q4KLY4 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
