The store will not work correctly when cookies are disabled.
Protein or Target Summary
Platelet basic protein
| Gene ID | 5473 |
|---|
| uniprot | P02775 |
|---|
| Gene Name | PPBP |
|---|
| Ensernbl ID | ENSP00000296028 |
|---|
| Family | Belongs to the intercrine alpha (chemokine CxC) family. |
|---|
| Sequence | MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5473 | PPBP | Platelet basic protein | P02775 |
| MOUSE | 57349 | Ppbp | Chemokine (C-X-C motif) ligand 7, isoform CRA_b | Q9EQI5 |
| RAT | 246358 | Ppbp | CXC chemokine RTCK1 | Q99ME0 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
