The store will not work correctly when cookies are disabled.
MMP1
| Description | Interstitial collagenase |
|---|
Gene and Protein Information
| Gene ID | 4312 |
|---|
| Uniprot Accession IDs | P08156 |
|---|
| Ensembl ID | ENSP00000322788 |
|---|
| Symbol | CLG CLG CLGN |
|---|
| Family | Belongs to the peptidase M10A family. |
|---|
| Sequence | MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 451510 | MMP1 | matrix metallopeptidase 1 | 9598 | VGNC:1097 | OMA, EggNOG |
| Macaque | 703653 | MMP1 | matrix metallopeptidase 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 83996 | Mmp1b | matrix metallopeptidase 1b (interstitial collagenase) | 10090 | MGI:1933847 | Inparanoid, OMA, EggNOG |
| Rat | 300339 | Mmp1 | matrix metallopeptidase 1 | 10116 | RGD:1307917 | OMA, EggNOG |
| Dog | 489428 | MMP1 | matrix metallopeptidase 1 | 9615 | VGNC:43273 | Inparanoid, OMA, EggNOG |
| Horse | 100033896 | MMP1 | matrix metallopeptidase 1 | 9796 | VGNC:49488 | Inparanoid, OMA, EggNOG |
| Cow | 281308 | MMP1 | matrix metallopeptidase 1 (interstitial collagenase) | 9913 | | Inparanoid, OMA, EggNOG |
| Pig | | MMP3 | Interstitial collagenase 18 kDa interstitial collagenase [Source:UniProtKB/Swiss-Prot;Acc:P21692] | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100012472 | LOC100012472 | interstitial collagenase | 13616 | | OMA, EggNOG |
| Platypus | 100078975 | LOC100078975 | interstitial collagenase | 9258 | | OMA, EggNOG |
| Chicken | 418982 | MMP1 | matrix metallopeptidase 1 | 9031 | CGNC:50888 | Inparanoid, OMA |
| Anole lizard | 100552848 | LOC100552848 | interstitial collagenase-like | 28377 | | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
