The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
MMP7
Gene and Protein Information
Gene ID | 4316 |
Uniprot Accession IDs | P09237 Q9BTK9 |
Ensembl ID | ENSP00000260227 |
Symbol | MPSL1 PUMP1 MMP-7 MPSL1 PUMP-1 |
Family | Belongs to the peptidase M10A family. |
Sequence | MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 451509 | MMP7 | matrix metallopeptidase 7 | 9598 | VGNC:1103 | OMA, EggNOG |
Macaque | 703072 | MMP7 | matrix metallopeptidase 7 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 17393 | Mmp7 | matrix metallopeptidase 7 | 10090 | MGI:103189 | Inparanoid, OMA, EggNOG |
Rat | 25335 | Mmp7 | matrix metallopeptidase 7 | 10116 | RGD:3100 | Inparanoid, OMA, EggNOG |
Dog | 489432 | MMP7 | matrix metallopeptidase 7 | 9615 | VGNC:43288 | Inparanoid, OMA, EggNOG |
Horse | 100068985 | MMP7 | matrix metallopeptidase 7 | 9796 | VGNC:20235 | Inparanoid, OMA, EggNOG |
Cow | 286794 | MMP7 | matrix metallopeptidase 7 | 9913 | VGNC:31529 | Inparanoid, OMA, EggNOG |
Pig | 397411 | MMP7 | matrix metallopeptidase 7 | 9823 | | Inparanoid, OMA, EggNOG |
Opossum | 100012296 | MMP7 | matrix metallopeptidase 7 | 13616 | | Inparanoid, OMA, EggNOG |
Platypus | 100079035 | LOC100079035 | matrilysin | 9258 | | OMA, EggNOG |
Chicken | 418983 | MMP7 | matrix metallopeptidase 7 | 9031 | CGNC:50889 | Inparanoid, OMA, EggNOG |
Anole lizard | 100553835 | LOC100553835 | matrilysin | 28377 | | Inparanoid, OMA |
Anole lizard | 100553635 | LOC100553635 | macrophage metalloelastase | 28377 | | OMA, EggNOG |
Associated Recombinant Proteins
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
The page will load shortly, Thanks for your patience!
Bibliography
The page will load shortly, Thanks for your patience!