The store will not work correctly when cookies are disabled.
Gene and Protein Information
| Gene ID | 5650 |
|---|
| Uniprot Accession IDs | A8K0U5 Q8N5N9 Q8NFV7 hK7 |
|---|
| Ensembl ID | ENSP00000375683 |
|---|
| Symbol | PRSS6 SCCE hK7 SCCE PRSS6 |
|---|
| Family | Belongs to the peptidase S1 family. Kallikrein subfamily. |
|---|
| Sequence | MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 722683 | KLK7 | kallikrein related peptidase 7 | 9544 | | OMA, EggNOG |
| Mouse | 23993 | Klk7 | kallikrein related-peptidase 7 (chymotryptic, stratum corneum) | 10090 | MGI:1346336 | Inparanoid, OMA, EggNOG |
| Cow | 506380 | KLK7 | kallikrein related peptidase 7 | 9913 | VGNC:30681 | Inparanoid, OMA, EggNOG |
| Opossum | 100012470 | LOC100012470 | kallikrein-7 | 13616 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
