The store will not work correctly when cookies are disabled.
Protein or Target Summary
Kallikrein-7
| Gene ID | 5650 |
|---|
| uniprot | P49862 |
|---|
| Gene Name | KLK7 |
|---|
| Ensernbl ID | ENSP00000375683 |
|---|
| Family | Belongs to the peptidase S1 family. Kallikrein subfamily. |
|---|
| Sequence | MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5650 | KLK7 | Kallikrein-7 | P49862 |
| MOUSE | 23993 | Klk7 | Kallikrein 7 (Chymotryptic, stratum corneum) | A0A0B6VPC4 |
| MOUSE | 23993 | Klk7 | Kallikrein-7 | Q91VE3 |
| RAT | 292852 | Klk7 | Glandular kallikrein-7, submandibular/renal | D3ZZY0 |
| RAT | 24523 | Klk7 | Glandular kallikrein-7, submandibular/renal | P36373 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
