Protein or Target Summary
Mitogen-activated protein kinase 12
| Gene ID | 6300 |
|---|---|
| uniprot | P53778 |
| Gene Name | MAPK12 |
| Ensernbl ID | ENSP00000215659 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily. |
| Sequence | MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 6300 | MAPK12 | Mitogen-activated protein kinase 12 | P53778 |
| MOUSE | Mapk12 | Mapk12 protein | Q99M09 | |
| MOUSE | 29857 | Mapk12 | Mitogen-activated protein kinase 12 | O08911 |
| RAT | Mapk12 | Mapk12 protein | A0JPR2 | |
| RAT | Mapk12 | Mapk12 protein | Q66HA3 | |
| RAT | 60352 | Mapk12 | Mitogen-activated protein kinase 12 | Q63538 |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Mitogen-activated protein kinase 12
protein / protein kinase / Mitogen-activated protein kinase 12
protein / transferase / Mitogen-activated protein kinase 12
protein / kinase / Mitogen-activated protein kinase 12
protein / non-receptor serine/threonine protein kinase / Mitogen-activated protein kinase 12
protein / protein kinase / Mitogen-activated protein kinase 12
protein / transferase / Mitogen-activated protein kinase 12
protein / kinase / Mitogen-activated protein kinase 12
DTO Classes
protein / Kinase / Protein kinase / CMGC group / MAPK family / P38 subfamily / Mitogen-activated protein kinase 12
protein / Kinase / Protein kinase / CMGC group / MAPK family / P38 subfamily / Mitogen-activated protein kinase 12
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx