The store will not work correctly when cookies are disabled.
Gene and Protein Information
| Gene ID | 4322 |
|---|
| Uniprot Accession IDs | A8K846 B2RCZ3 Q6NWN6 |
|---|
| Ensembl ID | ENSP00000260302 |
|---|
| Symbol | CLG3 MDST MANDP1 MMP-13 |
|---|
| Family | Belongs to the peptidase M10A family. |
|---|
| Sequence | MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 451513 | MMP13 | matrix metallopeptidase 13 | 9598 | VGNC:1095 | OMA, EggNOG |
| Macaque | 703980 | MMP13 | matrix metallopeptidase 13 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 17386 | Mmp13 | matrix metallopeptidase 13 | 10090 | MGI:1340026 | Inparanoid, OMA, EggNOG |
| Rat | 171052 | Mmp13 | matrix metallopeptidase 13 | 10116 | RGD:620196 | Inparanoid, OMA, EggNOG |
| Dog | 403763 | MMP13 | matrix metallopeptidase 13 | 9615 | VGNC:43276 | Inparanoid, OMA, EggNOG |
| Horse | 100009711 | MMP13 | matrix metallopeptidase 13 | 9796 | VGNC:49489 | Inparanoid, OMA, EggNOG |
| Cow | 281914 | MMP13 | matrix metallopeptidase 13 | 9913 | VGNC:31518 | Inparanoid, OMA, EggNOG |
| Pig | 397346 | MMP13 | matrix metallopeptidase 13 | 9823 | | OMA, EggNOG |
| Opossum | 100012553 | MMP13 | matrix metallopeptidase 13 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | | MMP13 | matrix metallopeptidase 13 [Source:HGNC Symbol;Acc:HGNC:7159] | 9258 | | OMA, EggNOG |
| Chicken | 395683 | MMP13 | matrix metallopeptidase 13 | 9031 | CGNC:49430 | Inparanoid, OMA |
| Anole lizard | 100552256 | mmp13 | matrix metallopeptidase 13 | 28377 | | Inparanoid, OMA |
| Xenopus | 100490019 | mmp13l | matrix metallopeptidase 13 (collagenase 3) like | 8364 | XB-GENE-481559 | Inparanoid, OMA |
| Zebrafish | 100006896 | mmp13b | matrix metallopeptidase 13b | 7955 | ZDB-GENE-030131-6152 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
