The store will not work correctly when cookies are disabled.
LGALS7
Gene and Protein Information
| Gene ID | 3963 |
|---|
| Uniprot Accession IDs | Q6IB87 Gal-7 |
|---|
| Ensembl ID | ENSP00000367891 |
|---|
| Symbol | PIG1 GAL7 LGALS7A |
|---|
| Sequence | MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Mouse | 16858 | Lgals7 | lectin, galactose binding, soluble 7 | 10090 | MGI:1316742 | Inparanoid, OMA, EggNOG |
| Rat | 29518 | Lgals7 | galectin 7 | 10116 | RGD:61951 | Inparanoid, OMA, EggNOG |
| Dog | 100686721 | LGALS7 | galectin 7 | 9615 | | OMA, EggNOG |
| Horse | 100066399 | LOC100066399 | galectin-7 | 9796 | | Inparanoid, OMA, EggNOG |
| Cow | 787811 | LGALS7 | galectin 7 | 9913 | | OMA, EggNOG |
| Cow | 100298130 | LGALS7B | lectin, galactoside-binding, soluble, 7B | 9913 | | Inparanoid, OMA |
| Pig | 110260983 | LOC110260983 | galectin-7-like | 9823 | | OMA, EggNOG |
| Opossum | 100013497 | LOC100013497 | galectin-7 | 13616 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100564936 | LOC100564936 | galectin-7 | 28377 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
