The store will not work correctly when cookies are disabled.
Protein or Target Summary
Excitatory amino acid transporter 5
| Gene ID | 6512 |
|---|
| uniprot | O00341 |
|---|
| Gene Name | SLC1A7 |
|---|
| Ensernbl ID | ENSP00000478639 |
|---|
| Family | Belongs to the dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family. SLC1A7 subfamily. |
|---|
| Sequence | MVPHAILARGRDVCRRNGLLILSVLSVIVGCLLGFFLRTRRLSPQEISYFQFPGELLMRMLKMMILPLVVSSLMSGLASLDAKTSSRLGVLTVAYYLWTTFMAVIVGIFMVSIIHPGSAAQKETTEQSGKPIMSSADALLDLIRNMFPANLVEATFKQYRTKTTPVVKSPKVAPEEAPPRRILIYGVQEENGSHVQNFALDLTPPPEVVYKSEPGTSDGMNVLGIVFFSATMGIMLGRMGDSGAPLVSFCQCLNESVMKIVAVAVWYFPFGIVFLIAGKILEMDDPRAVGKKLGFYSVTVVCGLVLHGLFILPLLYFFITKKNPIVFIRGILQALLIALATSSSSATLPITFKCLLENNHIDRRIARFVLPVGATINMDGTALYEAVAAIFIAQVNNYELDFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWALDRFRTMINVLGDALAAGIMAHICRKDFARDTGTEKLLPCETKPVSLQEIVAAQQNGCVKSVAEASELTLGPTCPHHVPVQVEQDEELPAASLNHCTIQISELETNV Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 6512 | SLC1A7 | Excitatory amino acid transporter 5 | O00341 |
| MOUSE | 242607 | Slc1a7 | Excitatory amino acid transporter 5 | Q8JZR4 |
| MOUSE | | Slc1a7 | Amino acid transporter | Q7TQH6 |
| MOUSE | 242607 | Slc1a7 | Amino acid transporter | Z4YKJ7 |
| RAT | | Slc1a7 | Amino acid transporter | F2YRM6 |
| RAT | 366432 | Slc1a7 | Amino acid transporter | F2YRM5 |
| RAT | | Slc1a7 | Amino acid transporter | F2YRM9 |
| RAT | 366432 | Slc1a7 | Amino acid transporter | D3ZT83 |
| RAT | 366432 | Slc1a7 | Amino acid transporter | F2YRM7 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
