The store will not work correctly when cookies are disabled.
SLC1A7
| Description | Excitatory amino acid transporter 5 |
|---|
Gene and Protein Information
| Gene ID | 6512 |
|---|
| Uniprot Accession IDs | Q5VVZ0 Q969Z8 Q9BW45 |
|---|
| Ensembl ID | ENSP00000478639 |
|---|
| Symbol | EAAT5 AAAT EAAT5 |
|---|
| Family | Belongs to the dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family. SLC1A7 subfamily. |
|---|
| Sequence | MVPHAILARGRDVCRRNGLLILSVLSVIVGCLLGFFLRTRRLSPQEISYFQFPGELLMRMLKMMILPLVVSSLMSGLASLDAKTSSRLGVLTVAYYLWTTFMAVIVGIFMVSIIHPGSAAQKETTEQSGKPIMSSADALLDLIRNMFPANLVEATFKQYRTKTTPVVKSPKVAPEEAPPRRILIYGVQEENGSHVQNFALDLTPPPEVVYKSEPGTSDGMNVLGIVFFSATMGIMLGRMGDSGAPLVSFCQCLNESVMKIVAVAVWYFPFGIVFLIAGKILEMDDPRAVGKKLGFYSVTVVCGLVLHGLFILPLLYFFITKKNPIVFIRGILQALLIALATSSSSATLPITFKCLLENNHIDRRIARFVLPVGATINMDGTALYEAVAAIFIAQVNNYELDFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWALDRFRTMINVLGDALAAGIMAHICRKDFARDTGTEKLLPCETKPVSLQEIVAAQQNGCVKSVAEASELTLGPTCPHHVPVQVEQDEELPAASLNHCTIQISELETNV Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 469329 | SLC1A7 | solute carrier family 1 member 7 | 9598 | VGNC:8104 | Inparanoid, OMA, EggNOG |
| Macaque | 714080 | SLC1A7 | solute carrier family 1 member 7 | 9544 | | OMA, EggNOG |
| Mouse | 242607 | Slc1a7 | solute carrier family 1 (glutamate transporter), member 7 | 10090 | MGI:2444087 | Inparanoid, OMA, EggNOG |
| Rat | 366432 | Slc1a7 | solute carrier family 1 member 7 | 10116 | RGD:1311928 | Inparanoid, OMA, EggNOG |
| Dog | 100505395 | SLC1A7 | solute carrier family 1 member 7 | 9615 | VGNC:46267 | Inparanoid, OMA, EggNOG |
| Horse | 100061161 | SLC1A7 | solute carrier family 1 member 7 | 9796 | VGNC:23065 | Inparanoid, OMA, EggNOG |
| Cow | 523673 | SLC1A7 | solute carrier family 1 member 7 | 9913 | VGNC:34716 | Inparanoid, OMA, EggNOG |
| Pig | 100519664 | SLC1A7 | solute carrier family 1 member 7 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100017699 | SLC1A7 | solute carrier family 1 member 7 | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 429106 | SLC1A7 | solute carrier family 1 member 7 | 9031 | CGNC:8109 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100563339 | slc1a7 | solute carrier family 1 member 7 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | | slc1a7 | solute carrier family 1 (glutamate transporter), member 7 [Source:Xenbase;Acc:XB-GENE-979919] | 8364 | | OMA, EggNOG |
| Zebrafish | 100170783 | slc1a7a | solute carrier family 1 (glutamate transporter), member 7a | 7955 | ZDB-GENE-061009-24 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
