The store will not work correctly when cookies are disabled.
KLK1
Gene and Protein Information
Gene ID | 3816 |
Uniprot Accession IDs | Q66US9 Q86U61 Q8TCV8 Q9BS53 Q9NQU4 Q9UD19 Q9UMJ1 |
Ensembl ID | ENSP00000301420 |
Symbol | hK1 KLKR Klk6 |
Family | Belongs to the peptidase S1 family. Kallikrein subfamily. |
Sequence | MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Mouse | 16624 | Klk1b8 | kallikrein 1-related peptidase b8 | 10090 | MGI:892018 | Inparanoid, OMA |
Rat | | Klk1b3 | kallikrein 1-related peptidase B3 [Source:RGD Symbol;Acc:3175] | 10116 | | Inparanoid, OMA |
Cow | 493738 | KLK1 | kallikrein 1 | 9913 | | Inparanoid, OMA |
Pig | 431673 | KLK1 | kallikrein 1 | 9823 | | Inparanoid, OMA |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|