The store will not work correctly when cookies are disabled.
Gene and Protein Information
| Gene ID | 3817 |
|---|
| Uniprot Accession IDs | B4DU93 B4DUB0 F5H8L3 Q15946 Q9UJZ9 |
|---|
| Ensembl ID | ENSP00000313581 |
|---|
| Symbol | hK2 hGK-1 KLK2A2 |
|---|
| Family | Belongs to the peptidase S1 family. Kallikrein subfamily. |
|---|
| Sequence | MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP |
|---|
Homologous gene and protein info.
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
