The store will not work correctly when cookies are disabled.
KLK3
| Description | Prostate-specific antigen |
|---|
Gene and Protein Information
| Gene ID | 354 |
|---|
| Uniprot Accession IDs | C9JXH3 G3V0H4 G3XAE3 Q15096 Q16272 Q86TG8 Q8IXI4 PSA |
|---|
| Ensembl ID | ENSP00000314151 |
|---|
| Symbol | APS APS PSA hK3 KLK2A1 |
|---|
| Family | Belongs to the peptidase S1 family. Kallikrein subfamily. |
|---|
| Sequence | MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 493182 | KLK3 | kallikrein related peptidase 3 | 9598 | VGNC:11150 | Inparanoid, OMA |
| Macaque | 719444 | KLK3 | kallikrein 3 | 9544 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
