JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Kallikrein-8

Gene ID	11202
uniprot	O60259
Gene Name	KLK8
Ensernbl ID	ENSP00000375682
Family	Belongs to the peptidase S1 family. Kallikrein subfamily.
Sequence	MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	11202	KLK8	Kallikrein-8	O60259
MOUSE		Klk8	Kallikrein-8	A0A0U1RNI7
MOUSE	259277	Klk8	Kallikrein h	A0A0B6VRH9
MOUSE	259277	Klk8	Kallikrein-8	Q61955
RAT	308565	Klk8	Kallikrein 8 (Neuropsin/ovasin)	G3V8E9
RAT		Klk8	Kallikrein-8	O88780

Protein Classes

PANTHER Classes
protein / serine protease / Kallikrein-8

DTO Classes
protein / Enzyme / Protease / Serine protease / Kallikrein-8

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx