The store will not work correctly when cookies are disabled.
Gene and Protein Information
| Gene ID | 4738 |
|---|
| Uniprot Accession IDs | Q3SXN8 Q6LES6 |
|---|
| Ensembl ID | ENSP00000250495 |
|---|
| Symbol | NEDD-8 |
|---|
| Family | Belongs to the ubiquitin family. |
|---|
| Sequence | MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | | NEDD8 | magnesium dependent phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:28781] | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 18002 | Nedd8 | neural precursor cell expressed, developmentally down-regulated gene 8 | 10090 | MGI:97301 | Inparanoid, OMA, EggNOG |
| Rat | 25490 | Nedd8 | neural precursor cell expressed, developmentally down-regulated 8 | 10116 | RGD:3158 | Inparanoid, OMA, EggNOG |
| Dog | 480265 | NEDD8 | neural precursor cell expressed, developmentally down-regulated 8 | 9615 | | Inparanoid, OMA, EggNOG |
| Horse | 100051307 | NEDD8 | neural precursor cell expressed, developmentally down-regulated 8 | 9796 | | Inparanoid, OMA, EggNOG |
| Cow | 286796 | NEDD8 | neural precursor cell expressed, developmentally down-regulated 8 | 9913 | | Inparanoid, OMA, EggNOG |
| Opossum | 103101483 | NEDD8 | neural precursor cell expressed, developmentally down-regulated 8 | 13616 | | Inparanoid, EggNOG |
| Xenopus | 549727 | nedd8 | neural precursor cell expressed, developmentally down-regulated 8 | 8364 | XB-GENE-6067551 | Inparanoid, OMA, EggNOG |
| Zebrafish | 368667 | nedd8 | neural precursor cell expressed, developmentally down-regulated 8 | 7955 | ZDB-GENE-030616-588 | Inparanoid, OMA, EggNOG |
| C. elegans | 172910 | ned-8 | NEDD8 | 6239 | | Inparanoid, OMA, EggNOG |
| Fruitfly | 35151 | Nedd8 | CG10679 gene product from transcript CG10679-RB | 7227 | FBgn0032725 | Inparanoid, EggNOG |
| S.cerevisiae | 851717 | RUB1 | NEDD8 family protein RUB1 | 4932 | S000002546 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
