Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

NEDD8

DescriptionNEDD8

Gene and Protein Information

Gene ID4738
Uniprot Accession IDs Q3SXN8 Q6LES6
Ensembl ID ENSP00000250495
Symbol NEDD-8
FamilyBelongs to the ubiquitin family.
Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
MacaqueNEDD8magnesium dependent phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:28781]9544Inparanoid, OMA, EggNOG
Mouse18002Nedd8neural precursor cell expressed, developmentally down-regulated gene 810090MGI:97301Inparanoid, OMA, EggNOG
Rat25490Nedd8neural precursor cell expressed, developmentally down-regulated 810116RGD:3158Inparanoid, OMA, EggNOG
Dog480265NEDD8neural precursor cell expressed, developmentally down-regulated 89615Inparanoid, OMA, EggNOG
Horse100051307NEDD8neural precursor cell expressed, developmentally down-regulated 89796Inparanoid, OMA, EggNOG
Cow286796NEDD8neural precursor cell expressed, developmentally down-regulated 89913Inparanoid, OMA, EggNOG
Opossum103101483NEDD8neural precursor cell expressed, developmentally down-regulated 813616Inparanoid, EggNOG
Xenopus549727nedd8neural precursor cell expressed, developmentally down-regulated 88364XB-GENE-6067551Inparanoid, OMA, EggNOG
Zebrafish368667nedd8neural precursor cell expressed, developmentally down-regulated 87955ZDB-GENE-030616-588Inparanoid, OMA, EggNOG
C. elegans172910ned-8NEDD86239Inparanoid, OMA, EggNOG
Fruitfly35151Nedd8CG10679 gene product from transcript CG10679-RB7227FBgn0032725Inparanoid, EggNOG
S.cerevisiae851717RUB1NEDD8 family protein RUB14932S000002546OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    ribosomal protein    /    NEDD8
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    Ribosomal protein    /    NEDD8

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.