Click Here for 5% Off Your First Aladdin Purchase!
Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

Protein or Target Summary

Mitotic spindle assembly checkpoint protein MAD2B

Gene ID10459
uniprotQ9UI95
Gene NameMAD2L2
Ensernbl IDENSP00000235310
Sequence
MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN10459MAD2L2Mitotic spindle assembly checkpoint protein MAD2BQ9UI95
MOUSE71890Mad2l2Mitotic spindle assembly checkpoint protein MAD2BA2A7G7
MOUSEMad2l2Mitotic spindle assembly checkpoint protein MAD2BA2A7G6
MOUSEMad2l2Mitotic spindle assembly checkpoint protein MAD2BA2A7G5
MOUSE71890Mad2l2Mitotic spindle assembly checkpoint protein MAD2BQ9D752
RATMad2l2Mitotic spindle assembly checkpoint protein MAD2BA0A0A0MP76
RATMad2l2Mitotic spindle assembly checkpoint protein MAD2BA0A096MJ62
RAT313702Mad2l2Mitotic spindle assembly checkpoint protein MAD2BD3Z8D9

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      Source: DataSourcesLicenses.xlsx
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.