JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Mannose-6-phosphate isomerase

Gene ID	4351
uniprot	P34949
Gene Name	MPI
Ensernbl ID	ENSP00000318318
Family	Belongs to the mannose-6-phosphate isomerase type 1 family.
Sequence	MAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACCLL Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	4351	MPI	Mannose-6-phosphate isomerase	P34949
MOUSE		Mpi	Mannose-6-phosphate isomerase	F6Q3K8
MOUSE		Mpi	Mannose-6-phosphate isomerase	Q921Z9
MOUSE	110119	Mpi	Mannose-6-phosphate isomerase	Q3V100
MOUSE	110119	Mpi	Mannose-6-phosphate isomerase	Q924M7
RAT	300741	Mpi	Mannose-6-phosphate isomerase	Q68FX1

Protein Classes

PANTHER Classes
protein / isomerase / Mannose-6-phosphate isomerase

DTO Classes
protein / Enzyme / Isomerase / Mannose-6-phosphate isomerase

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx