JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Monoglyceride lipase

Gene ID	11343
uniprot	Q99685
Gene Name	MGLL
Ensernbl ID	ENSP00000265052
Family	Belongs to the AB hydrolase superfamily. Monoacylglycerol lipase family.
Sequence	MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	11343	MGLL	Monoglyceride lipase	Q99685
MOUSE		Mgll	Monoglyceride lipase	D3YYS6
MOUSE	23945	Mgll	Monoglyceride lipase	E9Q3B9
MOUSE		Mgll	Uncharacterized protein	Q3UFX6
MOUSE		Mgll	Monoglyceride lipase	A0A0N4SUZ2
MOUSE	23945	Mgll	Monoglyceride lipase	Q3UFN1
MOUSE	23945	Mgll	Monoglyceride lipase	O35678
RAT		Mgll	Monoglyceride lipase	A0A0G2JYI5
RAT	29254	Mgll	Monoglyceride lipase	Q8R431

Protein Classes

PANTHER Classes
protein / hydrolase / phospholipase / Monoglyceride lipase

DTO Classes
protein / Enzyme / Hydrolase / Lipase / Phospholipase / Monoglyceride lipase

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx