JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Targets(Human)
MIA

MIA

Description	Melanoma-derived growth regulatory protein

Gene and Protein Information

Gene ID	8190
Uniprot Accession IDs	Q6FHV3
Ensembl ID	ENSP00000263369
Symbol	CD-RAP
Family	Belongs to the MIA/OTOR family.
Sequence	MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	456048	MIA	melanoma inhibitory activity	9598		OMA, EggNOG
Macaque	702844	MIA	melanoma inhibitory activity	9544		Inparanoid, OMA, EggNOG
Mouse		Gm21983	predicted gene 21983	10090	MGI:5439452	Inparanoid, OMA
Rat	81510	Mia	melanoma inhibitory activity	10116	RGD:620883	Inparanoid, OMA
Horse	100064799	MIA	melanoma inhibitory activity	9796		Inparanoid, OMA
Cow	280857	MIA	melanoma inhibitory activity	9913		Inparanoid, OMA
Xenopus	100216293	mia	melanoma inhibitory activity	8364	XB-GENE-974167	Inparanoid, OMA

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source