Click Here for 5% Off Your First Aladdin Purchase!
Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

Protein or Target Summary

Macrophage migration inhibitory factor

Gene ID4282
uniprotP14174
Gene NameMIF
Ensernbl IDENSP00000215754
FamilyBelongs to the MIF family.
Sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN4282MIFMacrophage migration inhibitory factorP14174
MOUSE17319MifMCG3124, isoform CRA_bQ545F0
MOUSE17319MifMacrophage migration inhibitory factorP34884
RAT81683MifMacrophage migration inhibitory factorA0A0F7RQL3
RAT81683MifMacrophage migration inhibitory factorP30904

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      Source: DataSourcesLicenses.xlsx
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.