The store will not work correctly when cookies are disabled.
MIF
| Description | Macrophage migration inhibitory factor |
|---|
Gene and Protein Information
| Gene ID | 4282 |
|---|
| Uniprot Accession IDs | A5Z1R8 B2R4S3 Q2V4Y5 Q6FHV0 MIF |
|---|
| Ensembl ID | ENSP00000215754 |
|---|
| Symbol | GLIF MMIF GIF GLIF MMIF |
|---|
| Family | Belongs to the MIF family. |
|---|
| Sequence | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | | MIF | Macrophage migration inhibitory factor [Source:UniProtKB/Swiss-Prot;Acc:Q6DN04] | 9544 | | Inparanoid, EggNOG |
| Mouse | 17319 | Mif | macrophage migration inhibitory factor (glycosylation-inhibiting factor) | 10090 | MGI:96982 | Inparanoid, OMA, EggNOG |
| Rat | | AC127887.1 | - | 10116 | | OMA, EggNOG |
| Horse | 100053618 | MIF | macrophage migration inhibitory factor | 9796 | VGNC:50485 | Inparanoid, OMA, EggNOG |
| Cow | 280858 | MIF | macrophage migration inhibitory factor | 9913 | VGNC:49557 | Inparanoid, OMA, EggNOG |
| Pig | 397412 | MIF | macrophage migration inhibitory factor | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | | MIF | macrophage migration inhibitory factor [Source:HGNC Symbol;Acc:HGNC:7097] | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | | MIF | macrophage migration inhibitory factor [Source:HGNC Symbol;Acc:HGNC:7097] | 9258 | | OMA, EggNOG |
| Chicken | 100857237 | MIF | macrophage migration inhibitory factor (glycosylation-inhibiting factor) | 9031 | CGNC:65768 | Inparanoid, OMA, EggNOG |
| Xenopus | | MIF | macrophage migration inhibitory factor [Source:HGNC Symbol;Acc:HGNC:7097] | 8364 | | OMA, EggNOG |
| Zebrafish | 751093 | mif | macrophage migration inhibitory factor | 7955 | ZDB-GENE-080708-1 | Inparanoid, OMA, EggNOG |
| C. elegans | 176615 | mif-1 | MIF (Macrophage migration Inhibitory Factor) related | 6239 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
