The store will not work correctly when cookies are disabled.
SLC16A10
| Description | Monocarboxylate transporter 10 |
|---|
Gene and Protein Information
| Gene ID | 117247 |
|---|
| Uniprot Accession IDs | B3KWY0 Q6ZMG0 Q8WVI5 MCT 10 |
|---|
| Ensembl ID | ENSP00000357844 |
|---|
| Symbol | MCT10 TAT1 TAT1 MCT10 PRO0813 |
|---|
| Family | Belongs to the major facilitator superfamily. Monocarboxylate porter (TC 2.A.1.13) family. |
|---|
| Sequence | MVLSQEEPDSARGTSEAQPLGPAPTGAAPPPGPGPSDSPEAAVEKVEVELAGPATAEPHEPPEPPEGGWGWLVMLAAMWCNGSVFGIQNACGVLFVSMLETFGSKDDDKMVFKTAWVGSLSMGMIFFCCPIVSVFTDLFGCRKTAVVGAAVGFVGLMSSSFVSSIEPLYLTYGIIFACGCSFAYQPSLVILGHYFKKRLGLVNGIVTAGSSVFTILLPLLLRVLIDSVGLFYTLRVLCIFMFVLFLAGFTYRPLATSTKDKESGGSGSSLFSRKKFSPPKKIFNFAIFKVTAYAVWAVGIPLALFGYFVPYVHLMKHVNERFQDEKNKEVVLMCIGVTSGVGRLLFGRIADYVPGVKKVYLQVLSFFFIGLMSMMIPLCSIFGALIAVCLIMGLFDGCFISIMAPIAFELVGAQDVSQAIGFLLGFMSIPMTVGPPIAGLLRDKLGSYDVAFYLAGVPPLIGGAVLCFIPWIHSKKQREISKTTGKEKMEKMLENQNSLLSSSSGMFKKESDSII Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 462941 | SLC16A10 | solute carrier family 16 member 10 | 9598 | VGNC:7910 | OMA, EggNOG |
| Mouse | 72472 | Slc16a10 | solute carrier family 16 (monocarboxylic acid transporters), member 10 | 10090 | MGI:1919722 | Inparanoid, OMA |
| Rat | 170566 | Slc16a10 | solute carrier family 16 member 10 | 10116 | RGD:69197 | Inparanoid, OMA |
| Dog | 612335 | SLC16A10 | solute carrier family 16 member 10 | 9615 | VGNC:46236 | Inparanoid, OMA, EggNOG |
| Horse | 100072381 | SLC16A10 | solute carrier family 16 member 10 | 9796 | VGNC:23036 | Inparanoid, OMA, EggNOG |
| Cow | 541240 | SLC16A10 | solute carrier family 16 member 10 | 9913 | VGNC:34684 | Inparanoid, OMA |
| Opossum | | SLC16A10 | solute carrier family 16 member 10 [Source:HGNC Symbol;Acc:HGNC:17027] | 13616 | | Inparanoid, OMA |
| Chicken | 421753 | SLC16A10 | solute carrier family 16 member 10 | 9031 | CGNC:11185 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100559511 | slc16a10 | solute carrier family 16 member 10 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100488837 | slc16a10 | solute carrier family 16 member 10 | 8364 | XB-GENE-1012623 | Inparanoid, OMA |
| Zebrafish | 566499 | slc16a10 | solute carrier family 16 (aromatic amino acid transporter), member 10 | 7955 | ZDB-GENE-040724-214 | Inparanoid, OMA |
| S.cerevisiae | 854030 | MCH4 | Mch4p | 4932 | S000005479 | Inparanoid, OMA |
Protein Classes
PANTHER Classes protein /
transporter / Monocarboxylate transporter 10
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
