Protein or Target Summary

Monocarboxylate transporter 10

Gene ID	117247
uniprot	Q8TF71
Gene Name	SLC16A10
Ensernbl ID	ENSP00000357844
Family	Belongs to the major facilitator superfamily. Monocarboxylate porter (TC 2.A.1.13) family.
Sequence	MVLSQEEPDSARGTSEAQPLGPAPTGAAPPPGPGPSDSPEAAVEKVEVELAGPATAEPHEPPEPPEGGWGWLVMLAAMWCNGSVFGIQNACGVLFVSMLETFGSKDDDKMVFKTAWVGSLSMGMIFFCCPIVSVFTDLFGCRKTAVVGAAVGFVGLMSSSFVSSIEPLYLTYGIIFACGCSFAYQPSLVILGHYFKKRLGLVNGIVTAGSSVFTILLPLLLRVLIDSVGLFYTLRVLCIFMFVLFLAGFTYRPLATSTKDKESGGSGSSLFSRKKFSPPKKIFNFAIFKVTAYAVWAVGIPLALFGYFVPYVHLMKHVNERFQDEKNKEVVLMCIGVTSGVGRLLFGRIADYVPGVKKVYLQVLSFFFIGLMSMMIPLCSIFGALIAVCLIMGLFDGCFISIMAPIAFELVGAQDVSQAIGFLLGFMSIPMTVGPPIAGLLRDKLGSYDVAFYLAGVPPLIGGAVLCFIPWIHSKKQREISKTTGKEKMEKMLENQNSLLSSSSGMFKKESDSII Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	117247	SLC16A10	Monocarboxylate transporter 10	Q8TF71
MOUSE		Slc16a10	Uncharacterized protein	Q9CSW3
MOUSE		Slc16a10	Uncharacterized protein	Q3UEL7
MOUSE		Slc16a10	Slc16a10 protein	Q7TPW2
MOUSE		Slc16a10	Monocarboxylate transporter 10	A0A1L1SVB8
MOUSE	72472	Slc16a10	Monocarboxylate transporter 10	Q3U9N9
RAT	170566	Slc16a10	Monocarboxylate transporter 10	G3V621
RAT	170566	Slc16a10	Monocarboxylate transporter 10	Q91Y77

Protein Classes

PANTHER Classes
protein / transporter / Monocarboxylate transporter 10

DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC16 family of monocarboxylate transporters / Monocarboxylate transporter 10

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx