The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
SLC25A20
Description | Mitochondrial carnitine/acylcarnitine carrier protein |
---|
Gene and Protein Information
Gene ID | 788 |
Uniprot Accession IDs | B2R7F4 Q9UIQ2 |
Ensembl ID | ENSP00000326305 |
Symbol | CAC CACT CAC CACT |
Family | Belongs to the mitochondrial carrier (TC 2.A.29) family. |
Sequence | MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNL Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 460354 | SLC25A20 | solute carrier family 25 member 20 | 9598 | VGNC:8008 | OMA, EggNOG |
Macaque | 709029 | SLC25A20 | solute carrier family 25 member 20 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 57279 | Slc25a20 | solute carrier family 25 (mitochondrial carnitine/acylcarnitine translocase), member 20 | 10090 | MGI:1928738 | Inparanoid, OMA, EggNOG |
Rat | 117035 | Slc25a20 | solute carrier family 25 member 20 | 10116 | RGD:621443 | Inparanoid, OMA, EggNOG |
Dog | 484774 | SLC25A20 | solute carrier family 25 member 20 | 9615 | VGNC:46299 | Inparanoid, OMA, EggNOG |
Cow | 518758 | SLC25A20 | solute carrier family 25 member 20 | 9913 | VGNC:34748 | Inparanoid, OMA, EggNOG |
Pig | 100524459 | SLC25A20 | solute carrier family 25 member 20 | 9823 | | OMA, EggNOG |
Opossum | 100619207 | SLC25A20 | solute carrier family 25 member 20 | 13616 | | OMA, EggNOG |
Platypus | 100089308 | LOC100089308 | mitochondrial carnitine/acylcarnitine carrier protein | 9258 | | Inparanoid, EggNOG |
Chicken | 416062 | SLC25A20 | solute carrier family 25 member 20 | 9031 | CGNC:66247 | Inparanoid, OMA |
Anole lizard | 100560902 | slc25a20 | solute carrier family 25 member 20 | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | 394703 | slc25a20.2 | solute carrier family 25 (carnitine/acylcarnitine translocase), member 20, gene 2 | 8364 | XB-GENE-971451 | Inparanoid, OMA, EggNOG |
Zebrafish | 393833 | slc25a20 | solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 | 7955 | ZDB-GENE-040426-1869 | Inparanoid, OMA, EggNOG |
C. elegans | 177530 | dif-1 | Protein dif-1 | 6239 | | Inparanoid, OMA, EggNOG |
Fruitfly | 33470 | colt | congested-like trachea | 7227 | FBgn0019830 | OMA, EggNOG |
S.cerevisiae | 854267 | CRC1 | carnitine:acyl carnitine antiporter | 4932 | S000005626 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands