The store will not work correctly when cookies are disabled.
SLC25A20
| Description | Mitochondrial carnitine/acylcarnitine carrier protein |
|---|
Gene and Protein Information
| Gene ID | 788 |
|---|
| Uniprot Accession IDs | B2R7F4 Q9UIQ2 |
|---|
| Ensembl ID | ENSP00000326305 |
|---|
| Symbol | CAC CACT CAC CACT |
|---|
| Family | Belongs to the mitochondrial carrier (TC 2.A.29) family. |
|---|
| Sequence | MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNL Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 460354 | SLC25A20 | solute carrier family 25 member 20 | 9598 | VGNC:8008 | OMA, EggNOG |
| Macaque | 709029 | SLC25A20 | solute carrier family 25 member 20 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 57279 | Slc25a20 | solute carrier family 25 (mitochondrial carnitine/acylcarnitine translocase), member 20 | 10090 | MGI:1928738 | Inparanoid, OMA, EggNOG |
| Rat | 117035 | Slc25a20 | solute carrier family 25 member 20 | 10116 | RGD:621443 | Inparanoid, OMA, EggNOG |
| Dog | 484774 | SLC25A20 | solute carrier family 25 member 20 | 9615 | VGNC:46299 | Inparanoid, OMA, EggNOG |
| Cow | 518758 | SLC25A20 | solute carrier family 25 member 20 | 9913 | VGNC:34748 | Inparanoid, OMA, EggNOG |
| Pig | 100524459 | SLC25A20 | solute carrier family 25 member 20 | 9823 | | OMA, EggNOG |
| Opossum | 100619207 | SLC25A20 | solute carrier family 25 member 20 | 13616 | | OMA, EggNOG |
| Platypus | 100089308 | LOC100089308 | mitochondrial carnitine/acylcarnitine carrier protein | 9258 | | Inparanoid, EggNOG |
| Chicken | 416062 | SLC25A20 | solute carrier family 25 member 20 | 9031 | CGNC:66247 | Inparanoid, OMA |
| Anole lizard | 100560902 | slc25a20 | solute carrier family 25 member 20 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 394703 | slc25a20.2 | solute carrier family 25 (carnitine/acylcarnitine translocase), member 20, gene 2 | 8364 | XB-GENE-971451 | Inparanoid, OMA, EggNOG |
| Zebrafish | 393833 | slc25a20 | solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 | 7955 | ZDB-GENE-040426-1869 | Inparanoid, OMA, EggNOG |
| C. elegans | 177530 | dif-1 | Protein dif-1 | 6239 | | Inparanoid, OMA, EggNOG |
| Fruitfly | 33470 | colt | congested-like trachea | 7227 | FBgn0019830 | OMA, EggNOG |
| S.cerevisiae | 854267 | CRC1 | carnitine:acyl carnitine antiporter | 4932 | S000005626 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
