SLC25A20

Description	Mitochondrial carnitine/acylcarnitine carrier protein

Gene and Protein Information

Gene ID	788
Uniprot Accession IDs	B2R7F4 Q9UIQ2
Ensembl ID	ENSP00000326305
Symbol	CAC CACT CAC CACT
Family	Belongs to the mitochondrial carrier (TC 2.A.29) family.
Sequence	MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNL Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	460354	SLC25A20	solute carrier family 25 member 20	9598	VGNC:8008	OMA, EggNOG
Macaque	709029	SLC25A20	solute carrier family 25 member 20	9544		Inparanoid, OMA, EggNOG
Mouse	57279	Slc25a20	solute carrier family 25 (mitochondrial carnitine/acylcarnitine translocase), member 20	10090	MGI:1928738	Inparanoid, OMA, EggNOG
Rat	117035	Slc25a20	solute carrier family 25 member 20	10116	RGD:621443	Inparanoid, OMA, EggNOG
Dog	484774	SLC25A20	solute carrier family 25 member 20	9615	VGNC:46299	Inparanoid, OMA, EggNOG
Cow	518758	SLC25A20	solute carrier family 25 member 20	9913	VGNC:34748	Inparanoid, OMA, EggNOG
Pig	100524459	SLC25A20	solute carrier family 25 member 20	9823		OMA, EggNOG
Opossum	100619207	SLC25A20	solute carrier family 25 member 20	13616		OMA, EggNOG
Platypus	100089308	LOC100089308	mitochondrial carnitine/acylcarnitine carrier protein	9258		Inparanoid, EggNOG
Chicken	416062	SLC25A20	solute carrier family 25 member 20	9031	CGNC:66247	Inparanoid, OMA
Anole lizard	100560902	slc25a20	solute carrier family 25 member 20	28377		Inparanoid, OMA, EggNOG
Xenopus	394703	slc25a20.2	solute carrier family 25 (carnitine/acylcarnitine translocase), member 20, gene 2	8364	XB-GENE-971451	Inparanoid, OMA, EggNOG
Zebrafish	393833	slc25a20	solute carrier family 25 (carnitine/acylcarnitine translocase), member 20	7955	ZDB-GENE-040426-1869	Inparanoid, OMA, EggNOG
C. elegans	177530	dif-1	Protein dif-1	6239		Inparanoid, OMA, EggNOG
Fruitfly	33470	colt	congested-like trachea	7227	FBgn0019830	OMA, EggNOG
S.cerevisiae	854267	CRC1	carnitine:acyl carnitine antiporter	4932	S000005626	Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC25 family of mitochondrial transporters / Mitochondrial amino acid transporter subfamily / Mitochondrial carnitine/acylcarnitine carrier protein

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source