Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

SLC25A20

DescriptionMitochondrial carnitine/acylcarnitine carrier protein

Gene and Protein Information

Gene ID788
Uniprot Accession IDs B2R7F4 Q9UIQ2
Ensembl ID ENSP00000326305
Symbol CAC CACT CAC CACT
FamilyBelongs to the mitochondrial carrier (TC 2.A.29) family.
Sequence
MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp460354SLC25A20solute carrier family 25 member 209598VGNC:8008OMA, EggNOG
Macaque709029SLC25A20solute carrier family 25 member 209544Inparanoid, OMA, EggNOG
Mouse57279Slc25a20solute carrier family 25 (mitochondrial carnitine/acylcarnitine translocase), member 2010090MGI:1928738Inparanoid, OMA, EggNOG
Rat117035Slc25a20solute carrier family 25 member 2010116RGD:621443Inparanoid, OMA, EggNOG
Dog484774SLC25A20solute carrier family 25 member 209615VGNC:46299Inparanoid, OMA, EggNOG
Cow518758SLC25A20solute carrier family 25 member 209913VGNC:34748Inparanoid, OMA, EggNOG
Pig100524459SLC25A20solute carrier family 25 member 209823OMA, EggNOG
Opossum100619207SLC25A20solute carrier family 25 member 2013616OMA, EggNOG
Platypus100089308LOC100089308mitochondrial carnitine/acylcarnitine carrier protein9258Inparanoid, EggNOG
Chicken416062SLC25A20solute carrier family 25 member 209031CGNC:66247Inparanoid, OMA
Anole lizard100560902slc25a20solute carrier family 25 member 2028377Inparanoid, OMA, EggNOG
Xenopus394703slc25a20.2solute carrier family 25 (carnitine/acylcarnitine translocase), member 20, gene 28364XB-GENE-971451Inparanoid, OMA, EggNOG
Zebrafish393833slc25a20solute carrier family 25 (carnitine/acylcarnitine translocase), member 207955ZDB-GENE-040426-1869Inparanoid, OMA, EggNOG
C. elegans177530dif-1Protein dif-16239Inparanoid, OMA, EggNOG
Fruitfly33470coltcongested-like trachea7227FBgn0019830OMA, EggNOG
S.cerevisiae854267CRC1carnitine:acyl carnitine antiporter4932S000005626Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC25 family of mitochondrial transporters    /    Mitochondrial amino acid transporter subfamily    /    Mitochondrial carnitine/acylcarnitine carrier protein

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Bibliography