The store will not work correctly when cookies are disabled.
Protein or Target Summary
Methylated-DNA--protein-cysteine methyltransferase
| Gene ID | 4255 |
|---|
| uniprot | P16455 |
|---|
| Gene Name | MGMT |
|---|
| Ensernbl ID | ENSP00000302111 |
|---|
| Family | Belongs to the MGMT family. |
|---|
| Sequence | MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 4255 | MGMT | Methylated-DNA--protein-cysteine methyltransferase | P16455 |
| MOUSE | 17314 | Mgmt | O-6-methylguanine-DNA methyltransferase | Q4VA39 |
| MOUSE | 17314 | Mgmt | Methylated-DNA--protein-cysteine methyltransferase | P26187 |
| RAT | 25332 | Mgmt | Methylated-DNA--protein-cysteine methyltransferase | P24528 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
