The store will not work correctly when cookies are disabled.
MGMT
| Description | Methylated-DNA--protein-cysteine methyltransferase |
|---|
Gene and Protein Information
| Gene ID | 4255 |
|---|
| Uniprot Accession IDs | Q5VY78 |
|---|
| Ensembl ID | ENSP00000302111 |
|---|
| Family | Belongs to the MGMT family. |
|---|
| Sequence | MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 737624 | MGMT | O-6-methylguanine-DNA methyltransferase | 9598 | VGNC:7280 | OMA, EggNOG |
| Macaque | 698134 | MGMT | O-6-methylguanine-DNA methyltransferase | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 17314 | Mgmt | O-6-methylguanine-DNA methyltransferase | 10090 | MGI:96977 | Inparanoid, OMA, EggNOG |
| Rat | 25332 | Mgmt | O-6-methylguanine-DNA methyltransferase | 10116 | RGD:3087 | Inparanoid, OMA, EggNOG |
| Dog | 442978 | MGMT | O-6-methylguanine-DNA methyltransferase | 9615 | VGNC:43213 | Inparanoid, OMA, EggNOG |
| Horse | 100049801 | MGMT | O-6-methylguanine-DNA methyltransferase | 9796 | VGNC:20163 | Inparanoid, OMA, EggNOG |
| Pig | 100155050 | MGMT | O-6-methylguanine-DNA methyltransferase | 9823 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100553369 | mgmt | O-6-methylguanine-DNA methyltransferase | 28377 | | Inparanoid, EggNOG |
| Xenopus | 496878 | mgmt | O-6-methylguanine-DNA methyltransferase | 8364 | XB-GENE-941688 | Inparanoid, OMA, EggNOG |
| Zebrafish | 553368 | mgmt | O-6-methylguanine-DNA methyltransferase | 7955 | ZDB-GENE-120614-1 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
