JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Cytochrome b5

Gene ID	1528
uniprot	P00167
Gene Name	CYB5A
Ensernbl ID	ENSP00000341625
Family	Belongs to the cytochrome b5 family.
Sequence	MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	1528	CYB5A	Cytochrome b5	P00167
MOUSE	109672	Cyb5a	Cytochrome b5	P56395
MOUSE		Cyb5a	Cytochrome b5	E0CY88
MOUSE	109672	Cyb5a	Cytochrome b-5, isoform CRA_a	G5E850
MOUSE	109672	Cyb5a	Cytochrome b-5, isoform CRA_d	Q544Z9
RAT	64001	Cyb5a	Cytochrome b5	P00173

Protein Classes

PANTHER Classes
protein / oxidoreductase / oxidase / Cytochrome b5

DTO Classes
protein / Enzyme / Oxidoreductase / Oxidase / Cytochrome b5

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx