The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
MCL1
Description | Induced myeloid leukemia cell differentiation protein Mcl-1 |
---|
Gene and Protein Information
Gene ID | 4170 |
Uniprot Accession IDs | B2R6B2 D3DV03 D3DV04 Q9HD91 Q9NRQ3 Q9NRQ4 Q9UHR7 Q9UHR8 Q9UHR9 Q9UNJ1 |
Ensembl ID | ENSP00000358022 |
Symbol | BCL2L3 TM EAT MCL1L MCL1S Mcl-1 BCL2L3 MCL1-ES bcl2-L-3 mcl1/EAT |
Family | Belongs to the Bcl-2 family. |
Sequence | MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 457274 | MCL1 | MCL1, BCL2 family apoptosis regulator | 9598 | VGNC:1312 | OMA, EggNOG |
Macaque | 707539 | MCL1 | MCL1, BCL2 family apoptosis regulator | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 17210 | Mcl1 | myeloid cell leukemia sequence 1 | 10090 | MGI:101769 | Inparanoid, OMA, EggNOG |
Dog | 403537 | MCL1 | MCL1, BCL2 family apoptosis regulator | 9615 | VGNC:43079 | Inparanoid, OMA, EggNOG |
Horse | 100054765 | MCL1 | MCL1, BCL2 family apoptosis regulator | 9796 | VGNC:20032 | Inparanoid, OMA, EggNOG |
Cow | 788087 | MCL1 | MCL1, BCL2 family apoptosis regulator | 9913 | | Inparanoid, OMA, EggNOG |
Opossum | 100017262 | MCL1 | MCL1, BCL2 family apoptosis regulator | 13616 | | Inparanoid, OMA, EggNOG |
Anole lizard | 100556744 | mcl1 | MCL1, BCL2 family apoptosis regulator | 28377 | | Inparanoid, EggNOG |
Xenopus | 100038211 | mcl1 | MCL1, BCL2 family apoptosis regulator | 8364 | XB-GENE-487620 | Inparanoid, EggNOG |
Zebrafish | 58122 | mcl1a | MCL1, BCL2 family apoptosis regulator a | 7955 | ZDB-GENE-000511-7 | Inparanoid, OMA |
Protein Classes
PANTHER Classes protein /
signaling molecule / Induced myeloid leukemia cell differentiation protein Mcl-1
DTO Classes protein /
Signaling / Induced myeloid leukemia cell differentiation protein Mcl-1
Associated Recombinant Proteins
Associated Approved Drugs
Associated Active Ligands