The store will not work correctly when cookies are disabled.
MCL1
| Description | Induced myeloid leukemia cell differentiation protein Mcl-1 |
|---|
Gene and Protein Information
| Gene ID | 4170 |
|---|
| Uniprot Accession IDs | B2R6B2 D3DV03 D3DV04 Q9HD91 Q9NRQ3 Q9NRQ4 Q9UHR7 Q9UHR8 Q9UHR9 Q9UNJ1 |
|---|
| Ensembl ID | ENSP00000358022 |
|---|
| Symbol | BCL2L3 TM EAT MCL1L MCL1S Mcl-1 BCL2L3 MCL1-ES bcl2-L-3 mcl1/EAT |
|---|
| Family | Belongs to the Bcl-2 family. |
|---|
| Sequence | MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 457274 | MCL1 | MCL1, BCL2 family apoptosis regulator | 9598 | VGNC:1312 | OMA, EggNOG |
| Macaque | 707539 | MCL1 | MCL1, BCL2 family apoptosis regulator | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 17210 | Mcl1 | myeloid cell leukemia sequence 1 | 10090 | MGI:101769 | Inparanoid, OMA, EggNOG |
| Dog | 403537 | MCL1 | MCL1, BCL2 family apoptosis regulator | 9615 | VGNC:43079 | Inparanoid, OMA, EggNOG |
| Horse | 100054765 | MCL1 | MCL1, BCL2 family apoptosis regulator | 9796 | VGNC:20032 | Inparanoid, OMA, EggNOG |
| Cow | 788087 | MCL1 | MCL1, BCL2 family apoptosis regulator | 9913 | | Inparanoid, OMA, EggNOG |
| Opossum | 100017262 | MCL1 | MCL1, BCL2 family apoptosis regulator | 13616 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100556744 | mcl1 | MCL1, BCL2 family apoptosis regulator | 28377 | | Inparanoid, EggNOG |
| Xenopus | 100038211 | mcl1 | MCL1, BCL2 family apoptosis regulator | 8364 | XB-GENE-487620 | Inparanoid, EggNOG |
| Zebrafish | 58122 | mcl1a | MCL1, BCL2 family apoptosis regulator a | 7955 | ZDB-GENE-000511-7 | Inparanoid, OMA |
Protein Classes
PANTHER Classes protein /
signaling molecule / Induced myeloid leukemia cell differentiation protein Mcl-1
DTO Classes protein /
Signaling / Induced myeloid leukemia cell differentiation protein Mcl-1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
