The store will not work correctly when cookies are disabled.
Protein or Target Summary
Methyl-CpG-binding domain protein 3
| Gene ID | 53615 |
|---|
| uniprot | O95983 |
|---|
| Gene Name | MBD3 |
|---|
| Ensernbl ID | ENSP00000412302 |
|---|
| Sequence | MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 53615 | MBD3 | Methyl-CpG-binding domain protein 3 | O95983 |
| MOUSE | | Mbd3 | Methyl-CpG-binding domain protein 3 | F6WZH1 |
| MOUSE | | Mbd3 | Methyl-CpG-binding domain protein 3 | D3YTR5 |
| MOUSE | 17192 | Mbd3 | Methyl-CpG-binding domain protein 3 | D3YTR4 |
| MOUSE | 17192 | Mbd3 | Methyl-CpG-binding domain protein 3 | Q9Z2D8 |
| RAT | | Mbd3 | Mbd3 protein | B2RZ64 |
| RAT | 362834 | Mbd3 | Methyl-CpG binding domain protein 3 (Predicted), isoform CRA_c | F7EY92 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
