Protein or Target Summary

Microtubule-associated proteins 1A/1B light chain 3B

Gene ID	81631
uniprot	Q9GZQ8
Gene Name	MAP1LC3B
Ensernbl ID	ENSP00000268607
Family	Belongs to the ATG8 family.
Sequence	MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	81631	MAP1LC3B	Microtubule-associated proteins 1A/1B light chain 3B	Q9GZQ8
MOUSE		Map1lc3b	Uncharacterized protein	Q8K161
MOUSE		Map1lc3b	Microtubule-associated proteins 1A/1B light chain 3B	M0QWT8
MOUSE		Map1lc3b	Microtubule-associated proteins 1A/1B light chain 3B	A0A1D5RLG5
MOUSE		Map1lc3b	Microtubule-associated protein 1 light chain 3 beta	Q2TBF9
MOUSE		Map1lc3b	MCG14171, isoform CRA_b	M0QWC2
MOUSE	67443	Map1lc3b	Microtubule-associated proteins 1A/1B light chain 3B	Q9CQV6
RAT		Map1lc3b	Microtubule-associated proteins 1A/1B light chain 3B	Q7TQ75
RAT	64862	Map1lc3b	Microtubule-associated proteins 1A/1B light chain 3B	Q62625

Protein Classes

PANTHER Classes
protein / cytoskeletal protein / non-motor microtubule binding protein / Microtubule-associated proteins 1A/1B light chain 3B

DTO Classes
protein / Cellular structure / Microtubule family cytoskeletal protein / Non-motor microtubule binding protein / Microtubule-associated proteins 1A/1B light chain 3B

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx