JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

MAP1LC3B

Description	Microtubule-associated proteins 1A/1B light chain 3B

Gene and Protein Information

Gene ID	81631
Uniprot Accession IDs	Q6NW02
Ensembl ID	ENSP00000268607
Symbol	MAP1ALC3 LC3B ATG8F MAP1LC3B-a MAP1A/1BLC3
Family	Belongs to the ATG8 family.
Sequence	MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	746157	MAP1LC3B	microtubule associated protein 1 light chain 3 beta	9598		Inparanoid, OMA, EggNOG
Dog	479619	MAP1LC3B	microtubule associated protein 1 light chain 3 beta	9615		OMA, EggNOG
Horse	100060547	LOC100060547	microtubule-associated proteins 1A/1B light chain 3B	9796		OMA, EggNOG
Cow	408001	MAP1LC3B	microtubule associated protein 1 light chain 3 beta	9913		Inparanoid, OMA, EggNOG
Pig	100462754	MAP1LC3B	microtubule associated protein 1 light chain 3 beta	9823		Inparanoid, OMA, EggNOG
Xenopus	394972	map1lc3b	microtubule associated protein 1 light chain 3 beta	8364	XB-GENE-953620	OMA, EggNOG

Protein Classes

PANTHER Classes
protein / cytoskeletal protein / non-motor microtubule binding protein / Microtubule-associated proteins 1A/1B light chain 3B

DTO Classes
protein / Cellular structure / Microtubule family cytoskeletal protein / Non-motor microtubule binding protein / Microtubule-associated proteins 1A/1B light chain 3B

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]