Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

LMAN1

DescriptionProtein ERGIC-53

Gene and Protein Information

Gene ID3998
Uniprot Accession IDs P49257 Q12895 Q8N5I7 Q9UQG1 Q9UQG2 Q9UQG3 Q9UQG4 Q9UQG5 Q9UQG6 Q9UQG7 Q9UQG8 Q9UQG9 Q9UQH0 Q9UQH1 Q9UQH2
Ensembl ID ENSP00000251047
Symbol ERGIC53 F5F8D MR60 gp58 F5F8D FMFD1 MCFD1 ERGIC53 ERGIC-53
Sequence
MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTVLFIGYIMYRSQQEAAAKKFF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp455448LMAN1lectin, mannose binding 19598VGNC:10016OMA, EggNOG
Macaque697449LMAN1lectin, mannose binding 19544Inparanoid, OMA, EggNOG
Mouse70361Lman1lectin, mannose-binding, 110090MGI:1917611Inparanoid, OMA, EggNOG
Rat116666Lman1lectin, mannose-binding, 110116RGD:71020Inparanoid, OMA, EggNOG
Dog476186LMAN1lectin, mannose binding 19615VGNC:42706Inparanoid, OMA, EggNOG
Horse100050262LMAN1lectin, mannose binding 19796VGNC:19697Inparanoid, OMA, EggNOG
Cow511649LMAN1lectin, mannose binding 19913VGNC:30918Inparanoid, OMA, EggNOG
Pig100153007LMAN1lectin, mannose binding 19823OMA, EggNOG
Opossum100021881LMAN1lectin, mannose binding 113616Inparanoid, OMA, EggNOG
Platypus100086248LOC100086248protein ERGIC-539258OMA, EggNOG
Anole lizard100562643lman1lectin, mannose binding 128377Inparanoid, OMA, EggNOG
Xenopus100494337lman1lectin, mannose binding 18364XB-GENE-492680Inparanoid, OMA, EggNOG
Zebrafish559775lman1lectin, mannose-binding, 17955ZDB-GENE-060201-4Inparanoid, OMA, EggNOG
C. elegans172799ile-1Intracellular LEctin6239Inparanoid, OMA, EggNOG
Fruitfly44679ergic53CG6822 gene product from transcript CG6822-RB7227FBgn0035909Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    membrane traffic protein    /    Protein ERGIC-53
DTO Classes
protein    /    Transporter    /    Protein ERGIC-53

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      The page will load shortly, Thanks for your patience!
      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      The page will load shortly, Thanks for your patience!