JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Targets(Human)
MMP26

MMP26

Description	Matrix metalloproteinase-26

Gene and Protein Information

Gene ID	56547
Uniprot Accession IDs	Q3MJ78 Q9GZS2 Q9NR87 MMP-26
Ensembl ID	ENSP00000369753
Family	Belongs to the peptidase M10A family.
Sequence	MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	450977	MMP26	matrix metallopeptidase 26	9598	VGNC:1100	OMA, EggNOG
Macaque	574248	MMP26	matrix metallopeptidase 26	9544		Inparanoid, OMA, EggNOG
Dog	610101	MMP26	matrix metallopeptidase 26	9615	VGNC:43285	Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein / metalloprotease / Matrix metalloproteinase-26

DTO Classes
protein / Enzyme / Protease / Metalloprotease / Matrix metalloproteinase-26

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source