The store will not work correctly when cookies are disabled.
MMP26
| Description | Matrix metalloproteinase-26 |
|---|
Gene and Protein Information
| Gene ID | 56547 |
|---|
| Uniprot Accession IDs | Q3MJ78 Q9GZS2 Q9NR87 MMP-26 |
|---|
| Ensembl ID | ENSP00000369753 |
|---|
| Family | Belongs to the peptidase M10A family. |
|---|
| Sequence | MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 450977 | MMP26 | matrix metallopeptidase 26 | 9598 | VGNC:1100 | OMA, EggNOG |
| Macaque | 574248 | MMP26 | matrix metallopeptidase 26 | 9544 | | Inparanoid, OMA, EggNOG |
| Dog | 610101 | MMP26 | matrix metallopeptidase 26 | 9615 | VGNC:43285 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
